Q8HY32_MONDO (Monodelphis domestica)
Description [+]
- Synonyms: Q8HY32_MONDO
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Metatheria; Monodelphis domestica
- Short gene description: P53 protein (Fragment). [Source:UniProtKB/TrEMBL;Acc:Q8HY32]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: Q8HY32_MONDO-M_domestica
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | P53_tetramer | 59 | 99 |
Protein sequence [+]
Q8HY32_MONDO | Monodelphis domestica | 13616 | length:126
RGQLLGRRSFEVRICACPGRDRRTEEENFHKKGGPSPQPSSESNKRALPTTPGSTPKAKK
KLVEGEYFTLQIRGRQRYELLREINEALELKEAHSRKEPEGSRPHRSQLKSKRGDSTPCQ
GKRLLV
KLVEGEYFTLQIRGRQRYELLREINEALELKEAHSRKEPEGSRPHRSQLKSKRGDSTPCQ
GKRLLV
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0002347 | response to tumor cell | biological_proccess | IEA |
GO:0006350 | transcription | biological_proccess | IEA |
GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0007049 | cell cycle | biological_proccess | IEA |
GO:0030308 | negative regulation of cell growth | biological_proccess | IEA |
GO:0045449 | regulation of transcription | biological_proccess | IEA |
GO:0045786 | negative regulation of cell cycle | biological_proccess | IEA |
GO:0003677 | DNA binding | mollecular_function | IEA |
GO:0003700 | transcription factor activity | mollecular_function | IEA |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSMODG00000007271
- Expression info from Arrayexpress [?] : ENSMODG00000007271
- Protein expression from Protein Atlas: [?] ENSMODG00000007271
Click on [?] for more information.