BBC3 (Mus musculus)
Description [+]
- Synonyms: BBC3, BBC3, BCL2 BINDING COMPONENT 3, PUMA
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: Bcl-2-binding component 3 (p53 up-regulated modulator of apoptosis) [Source:UniProtKB/Swiss-Prot;Acc:Q99ML1]
- Family: Bcl-2 family : BH3-only
- Process: apoptosis,
- Pathways: intrinsic pathway, pre-mitochondrial signaling events,
- Criteria: manually curated
- Curator comment:
- WIKI: BBC3-M_musculus
References [+]
- p53- and drug-induced apoptotic responses mediated by BH3-only proteins puma and noxa.
- Villunger A, Michalak EM, Coultas L, Mullauer F, Bock G, Ausserlechner MJ, Adams JM, Strasser A
- Apoptosis provoked by DNA damage requires the p53 tumor suppressor, but which of the many p53-regulated genes are required has remained unknown. Two genes induced by this transcription factor, noxa and puma (bbc3), stand out, because they encode BH3-only proteins, proapoptotic members of the Bcl-2 family required to initiate apoptosis. In mice with either noxa or puma disrupted, we observed decreased DNA damage-induced apoptosis in fibroblasts, although only loss of Puma protected lymphocytes from cell death. Puma deficiency also protected cells against diverse p53-independent cytotoxic insults, including cytokine deprivation and exposure to glucocorticoids, the kinase inhibitor staurosporine, or phorbol ester. Hence, Puma and Noxa are critical mediators of the apoptotic responses induced by p53 and other agents. Science. 2003 Nov 7;302(5647):1036-8. Epub 2003 Sep 18.
Structure & Sequence [+]
Protein sequence [+]
Bbc3 | Mus musculus | 10090 | length:193
MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLC
APTAPPAVTAALGGPRWPGGHRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPT
QAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRVMYNLFMGLLP
LPRDPGAPEMEPN
APTAPPAVTAALGGPRWPGGHRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPT
QAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRVMYNLFMGLLP
LPRDPGAPEMEPN
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | ISS |
| GO:0006919 | activation of caspase activity | biological_proccess | ISS |
| GO:0042771 | DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis | biological_proccess | IMP |
| GO:0043065 | positive regulation of apoptosis | biological_proccess | IMP |
| GO:0045926 | negative regulation of growth | biological_proccess | ISS |
| GO:0006915 | apoptosis | biological_proccess | IEA |
| GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
| GO:0030308 | negative regulation of cell growth | biological_proccess | ISO |
| GO:0006917 | induction of apoptosis | biological_proccess | ISO |
| GO:0005515 | protein binding | mollecular_function | ISS |
| GO:0005739 | mitochondrion | cell_component | ISS |
| GO:0005740 | mitochondrial envelope | cell_component | ISO |
Check GO Evidence Codes here
KEGG Pathways [+]
Curated Isoforms [+]
| Transcript | Translation |
|---|---|
| OTTMUST00000053027 * | OTTMUSP00000025190 * |
| OTTMUST00000053028 | OTTMUSP00000025191 |
| OTTMUST00000053029 |
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from MGI [?] MGI:2181667
- Ensembl genome browser [?] : ENSMUSG00000002083
- Expression info from Arrayexpress [?] : ENSMUSG00000002083
- Protein expression from Protein Atlas: [?] ENSMUSG00000002083
- Community gene edition from Wikigenes: [?] 170770
Click on [?] for more information.
