TRAF6 (Mus musculus)
Description [+]
- Synonyms: TRAF6
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: Tnf receptor-associated factor 6 Gene [Source:MGI (curated);Acc:Traf6-001]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TRAF6-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | zf-C3HC4 | 70 | 108 |
PFAM A | zf-TRAF | 151 | 202 |
PFAM A | zf-TRAF | 204 | 261 |
PFAM A | MATH | 365 | 509 |
Protein sequence [+]
Traf6 | Mus musculus | 10090 | length:530
MSLLNCENSCGSSQSSSDCCAAMAASCSAAVKDDSVSGSASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIE
DCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPI
PCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPED
PNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQQCNGI
YIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVH
TMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRNPKGFG
YVTFMHLEALRQGTFIKDDTLLVRCEVSTRFDMGGLRKEGFQPRSTDAGV
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIE
DCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPI
PCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPED
PNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQQCNGI
YIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVH
TMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRNPKGFG
YVTFMHLEALRQGTFIKDDTLLVRCEVSTRFDMGGLRKEGFQPRSTDAGV
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001503 | ossification | biological_proccess | IMP |
GO:0006955 | immune response | biological_proccess | IMP |
GO:0007165 | signal transduction | biological_proccess | IDA |
GO:0009887 | organ morphogenesis | biological_proccess | IMP |
GO:0019886 | antigen processing and presentation of exogenous peptide antigen via MHC class II | biological_proccess | IMP |
GO:0042088 | T-helper 1 type immune response | biological_proccess | IMP |
GO:0042475 | odontogenesis of dentine-containing tooth | biological_proccess | IMP |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0043011 | myeloid dendritic cell differentiation | biological_proccess | IMP |
GO:0045084 | positive regulation of interleukin-12 biosynthetic process | biological_proccess | IMP |
GO:0045410 | positive regulation of interleukin-6 biosynthetic process | biological_proccess | IMP |
GO:0048468 | cell development | biological_proccess | IMP |
GO:0051023 | regulation of immunoglobulin secretion | biological_proccess | IDA |
GO:0001843 | neural tube closure | biological_proccess | IMP |
GO:0019941 | modification-dependent protein catabolic process | biological_proccess | IEA |
GO:0016567 | protein ubiquitination | biological_proccess | IEA |
GO:0002726 | positive regulation of T cell cytokine production | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0050852 | T cell receptor signaling pathway | biological_proccess | IEA |
GO:0000209 | protein polyubiquitination | biological_proccess | IEA |
GO:0032743 | positive regulation of interleukin-2 production | biological_proccess | IEA |
GO:0007250 | activation of NF-kappaB-inducing kinase activity | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0004871 | signal transducer activity | mollecular_function | TAS |
GO:0004842 | ubiquitin-protein ligase activity | mollecular_function | IEA |
GO:0005624 | membrane fraction | cell_component | IDA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IDA |
GO:0000151 | ubiquitin ligase complex | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from MGI [?] MGI:108072
- Ensembl genome browser [?] : ENSMUSG00000027164
- Expression info from Arrayexpress [?] : ENSMUSG00000027164
- Protein expression from Protein Atlas: [?] ENSMUSG00000027164
- Community gene edition from Wikigenes: [?] 22034
Click on [?] for more information.