MAPK13 (Mus musculus)
Description [+]
- Synonyms: MAPK13
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: mitogen-activated protein kinase 13 Gene [Source:MGI (curated);Acc:Mapk13-001]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: MAPK13-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase | 25 | 308 |
PFAM A | Pkinase_Tyr | 25 | 288 |
Protein sequence [+]
Mapk13 | Mus musculus | 10090 | length:366
MSLTRKRGFYKQDINKTAWELPKTYLAPAHVGSGAYGAVCSAIDKRTGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMHHENVIGLLDVFTPASSLRSFHDFYLVMPFMQTDLQKIMGM
EFSEDKVQYLVYQMLKGLKYIHSAGIVHRDLKPGNLAVNEDCELKILDFGLARHTDTEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLKDKAAKSYIQSLPQSPKKDFTQLFPRASPQAADLLDKMLELDVDKRLTAA
QALAHPFFEPFRDPEEETEAQQPFDDALEHEKLSVDEWKQHIYKEISNFSPIARKDSRRR
SGMKLQ
QSEIFAKRAYRELLLLKHMHHENVIGLLDVFTPASSLRSFHDFYLVMPFMQTDLQKIMGM
EFSEDKVQYLVYQMLKGLKYIHSAGIVHRDLKPGNLAVNEDCELKILDFGLARHTDTEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLKDKAAKSYIQSLPQSPKKDFTQLFPRASPQAADLLDKMLELDVDKRLTAA
QALAHPFFEPFRDPEEETEAQQPFDDALEHEKLSVDEWKQHIYKEISNFSPIARKDSRRR
SGMKLQ
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0007049 | cell cycle | biological_proccess | IEA |
GO:0007243 | protein kinase cascade | biological_proccess | ISS |
GO:0007243 | protein kinase cascade | biological_proccess | IEA |
GO:0006950 | response to stress | biological_proccess | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0004707 | MAP kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0008339 | MP kinase activity | mollecular_function | ISS |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0016301 | kinase activity | mollecular_function | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | ISO |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0008339 | MP kinase activity | mollecular_function | IEA |
GO:0005625 | soluble fraction | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:1346864
- Ensembl genome browser [?] : ENSMUSG00000004864
- Expression info from Arrayexpress [?] : ENSMUSG00000004864
- Protein expression from Protein Atlas: [?] ENSMUSG00000004864
- Community gene edition from Wikigenes: [?] 26415
Click on [?] for more information.