ENDOG (Mus musculus)
Description [+]
- Synonyms: ENDOG
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: endonuclease G Gene [Source:MGI (curated);Acc:Endog-001]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: ENDOG-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Endonuclease_NS | 74 | 282 |
Protein sequence [+]
Endog | Mus musculus | 10090 | length:294
MRALRAGLTLALGAGLGAAAEHWRRREGKAPGLLGRVPLLPVVAADLPALPGGPAGGTGE
LAKYGLPGVAQLRSRESYVLSYDPRTRGALWVLEQLRPERLRGDGDRSACDFREDDSVHA
YHRATNADYRGSGFDRGHLAAAANHRWSQRAMDDTFYLSNVAPQVPHLNQNAWNNLERYS
RSLTRTYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAAGGQIE
LRSYVMPNAPVDETIPLERFLVPIESIERASGLLFVPNILARAGNLKAITAGSK
LAKYGLPGVAQLRSRESYVLSYDPRTRGALWVLEQLRPERLRGDGDRSACDFREDDSVHA
YHRATNADYRGSGFDRGHLAAAANHRWSQRAMDDTFYLSNVAPQVPHLNQNAWNNLERYS
RSLTRTYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAAGGQIE
LRSYVMPNAPVDETIPLERFLVPIESIERASGLLFVPNILARAGNLKAITAGSK
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001701 | in utero embryonic development | biological_proccess | IMP |
GO:0006309 | DNA fragmentation during apoptosis | biological_proccess | IMP |
GO:0034612 | response to tumor necrosis factor | biological_proccess | IMP |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IMP |
GO:0046677 | response to antibiotic | biological_proccess | IMP |
GO:0000287 | magnesium ion binding | mollecular_function | IEA |
GO:0003676 | nucleic acid binding | mollecular_function | IEA |
GO:0004519 | endonuclease activity | mollecular_function | IEA |
GO:0016787 | hydrolase activity | mollecular_function | IEA |
GO:0030145 | manganese ion binding | mollecular_function | IEA |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0004518 | nuclease activity | mollecular_function | IEA |
GO:0005739 | mitochondrion | cell_component | IDA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from MGI [?] MGI:1261433
- Ensembl genome browser [?] : ENSMUSG00000015337
- Expression info from Arrayexpress [?] : ENSMUSG00000015337
- Protein expression from Protein Atlas: [?] ENSMUSG00000015337
- Community gene edition from Wikigenes: [?] 13804
Click on [?] for more information.