BNIP3L (Mus musculus)
Description [+]
- Synonyms: BNIP3L, BNIP3L, BCL2/ADENOVIRUS E1B INTERACTING PROTEIN 3-LIKE
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like (NIP3-like protein X)(NIP3L) [Source:UniProtKB/Swiss-Prot;Acc:Q9Z2F7]
- Family: Bcl-2 family : BH3-only
- Process: apoptosis,
- Pathways: intrinsic pathway,
- Criteria: manually curated
- Curator comment:
- WIKI: BNIP3L-M_musculus
References [+]
- The E1B 19K/Bcl-2-binding protein Nip3 is a dimeric mitochondrial protein that activates apoptosis.
- Chen G, Ray R, Dubik D, Shi L, Cizeau J, Bleackley RC, Saxena S, Gietz RD, Greenberg AH
- Nip3 (nineteen kD interacting protein-3) is an E1B 19K and Bcl-2 binding protein of unknown function. Nip3 is detected as both a 60- and 30-kD protein in vivo and in vitro and exhibits strong homologous interaction in a yeast two-hybrid system indicating that it can homodimerize. Nip3 is expressed in mitochondria and a mutant (Nip3(163)) lacking the putative transmembrane domain and COOH terminus does not dimerize or localize to mitochondria. Transient transfection of epitope-tagged Nip3 in Rat-1 fibroblasts and MCF-7 breast carcinoma induces apoptosis within 12 h while cells transfected with the Nip3(163) mutant have a normal phenotype, suggesting that mitochondrial localization is necessary for induction of cell death. Nip3 overexpression increases the sensitivity to apoptosis induced by granzyme B and topoisomerase I and II inhibitors. After transfection, both Nip3 and Nip3(163) protein levels decrease steadily over 48 h indicating that the protein is rapidly degraded and this occurs in the absence of cell death. Bcl-2 overexpression initially delays the onset of apoptosis induced by Nip3 but the resistance is completely overcome in longer periods of incubation. Nip3 protein levels are much higher and persist longer in Bcl-2 expressing cells. In conclusion, Nip3 is an apoptosis-inducing dimeric mitochondrial protein that can overcome Bcl-2 suppression. J Exp Med. 1997 Dec 15;186(12):1975-83.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | BNIP3 | 1 | 218 |
Protein sequence [+]
Bnip3l | Mus musculus | 10090 | length:218
MSHLVEPPPPLHNNNNNCEEGEQPLPPPAGLNSSWVELPMNSSNGNENGNGKNGGLEHVP
SSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSE
EEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRAASLSMRKSGAMKKGGIF
SAEFLKVFIPSLFLSHVLALGLGIYIGKRLSTPSASTY
SSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSE
EEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRAASLSMRKSGAMKKGGIF
SAEFLKVFIPSLFLSHVLALGLGIYIGKRLSTPSASTY
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
| GO:0006917 | induction of apoptosis | biological_proccess | ISS |
| GO:0008634 | negative regulation of survival gene product expression | biological_proccess | ISS |
| GO:0051607 | defense response to virus | biological_proccess | ISS |
| GO:0006915 | apoptosis | biological_proccess | RCA |
| GO:0042981 | regulation of apoptosis | biological_proccess | RCA |
| GO:0005515 | protein binding | mollecular_function | IPI |
| GO:0005739 | mitochondrion | cell_component | IDA |
| GO:0005740 | mitochondrial envelope | cell_component | IEA |
| GO:0016021 | integral to membrane | cell_component | IEA |
| GO:0005634 | nucleus | cell_component | IEA |
| GO:0005635 | nuclear envelope | cell_component | IEA |
| GO:0005739 | mitochondrion | cell_component | ISS |
| GO:0005783 | endoplasmic reticulum | cell_component | IEA |
| GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Curated Isoforms [+]
| Transcript | Translation |
|---|---|
| OTTMUST00000057832 | OTTMUSP00000027960 |
| OTTMUST00000057833 * | OTTMUSP00000027961 * |
| OTTMUST00000057834 | |
| OTTMUST00000057835 | |
| OTTMUST00000057836 | |
| OTTMUST00000057837 | |
| OTTMUST00000057838 |
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from MGI [?] MGI:1332659
- Ensembl genome browser [?] : ENSMUSG00000022051
- Expression info from Arrayexpress [?] : ENSMUSG00000022051
- Protein expression from Protein Atlas: [?] ENSMUSG00000022051
- Community gene edition from Wikigenes: [?] 100044398
Click on [?] for more information.
