LTB (Mus musculus)
Description [+]
- Synonyms: LTB
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: lymphotoxin B Gene [Source:MGI Symbol;Acc:MGI:104796]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: LTB-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 168 | 305 |
Protein sequence [+]
Ltb | Mus musculus | 10090 | length:306
MGTRGLQGLGGRPQGRGCLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGRRVEKIIG
SGAQAQKRLDDSKPSCILPSPSSLSETPDPRLHPQRSNASRNLASTSQGPVAQSSREASA
WMTILSPAADSTPDPGVQQLPKGEPETDLNPELPAAHLIGAWMSGQGLSWEASQEEAFLR
SGAQFSPTHGLALPQDGVYYLYCHVGYRGRTPPAGRSRARSLTLRSALYRAGGAYGRGSP
ELLLEGAETVTPVVDPIGYGSLWYTSVGFGGLAQLRSGERVYVNISHPDMVDYRRGKTFF
GAVMVG
SGAQAQKRLDDSKPSCILPSPSSLSETPDPRLHPQRSNASRNLASTSQGPVAQSSREASA
WMTILSPAADSTPDPGVQQLPKGEPETDLNPELPAAHLIGAWMSGQGLSWEASQEEAFLR
SGAQFSPTHGLALPQDGVYYLYCHVGYRGRTPPAGRSRARSLTLRSALYRAGGAYGRGSP
ELLLEGAETVTPVVDPIGYGSLWYTSVGFGGLAQLRSGERVYVNISHPDMVDYRRGKTFF
GAVMVG
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001775 | cell activation | biological_proccess | IEA |
GO:0002037 | negative regulation of L-glutamate transport | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0008285 | negative regulation of cell proliferation | biological_proccess | IEA |
GO:0009612 | response to mechanical stimulus | biological_proccess | IEA |
GO:0010467 | gene expression | biological_proccess | IMP |
GO:0019722 | calcium-mediated signaling | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0043525 | positive regulation of neuron apoptosis | biological_proccess | IEA |
GO:0043588 | skin development | biological_proccess | IMP |
GO:0045084 | positive regulation of interleukin-12 biosynthetic process | biological_proccess | IMP |
GO:0045840 | positive regulation of mitosis | biological_proccess | IEA |
GO:0046325 | negative regulation of glucose import | biological_proccess | IEA |
GO:0048535 | lymph node development | biological_proccess | IMP |
GO:0050806 | positive regulation of synaptic transmission | biological_proccess | IEA |
GO:0051222 | positive regulation of protein transport | biological_proccess | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | TAS |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from MGI [?] MGI:104796
- Ensembl genome browser [?] : ENSMUSG00000024399
- Expression info from Arrayexpress [?] : ENSMUSG00000024399
- Protein expression from Protein Atlas: [?] ENSMUSG00000024399
- Community gene edition from Wikigenes: [?] 16994
Click on [?] for more information.