CD27 (Mus musculus)
Description [+]
- Synonyms: CD27
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: CD27 antigen Gene [Source:MGI (curated);Acc:Cd27-003]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CD27-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 27 | 62 |
PFAM A | TNFR_c6 | 65 | 104 |
Protein sequence [+]
Cd27 | Mus musculus | 10090 | length:250
MAWPPPYWLCMLGTLVGLSATLAPNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAA
QCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTEC
DPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDC
IRIFVTFSSMFLIFVLGAILFFHQRRNHGPNEDRQAVPEEPCPYSCPREEEGSAIPIQED
YRKPEPAFYP
QCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTEC
DPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDC
IRIFVTFSSMFLIFVLGAILFFHQRRNHGPNEDRQAVPEEPCPYSCPREEEGSAIPIQED
YRKPEPAFYP
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | ISS |
GO:0006917 | induction of apoptosis | biological_proccess | IPI |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0042100 | B cell proliferation | biological_proccess | NAS |
GO:0045078 | positive regulation of interferon-gamma biosynthetic process | biological_proccess | NAS |
GO:0045582 | positive regulation of T cell differentiation | biological_proccess | NAS |
GO:0046330 | positive regulation of JNK cascade | biological_proccess | IDA |
GO:0048305 | immunoglobulin secretion | biological_proccess | NAS |
GO:0045471 | response to ethanol | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0043027 | caspase inhibitor activity | mollecular_function | ISS |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0043027 | caspase inhibitor activity | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0005624 | membrane fraction | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from MGI [?] MGI:88326
- Ensembl genome browser [?] : ENSMUSG00000030336
- Expression info from Arrayexpress [?] : ENSMUSG00000030336
- Protein expression from Protein Atlas: [?] ENSMUSG00000030336
- Community gene edition from Wikigenes: [?] 21940
- entrezgene: 21940
- refseq_dna: NM_001033126
- refseq_dna: NM_001042564
- refseq_peptide: NP_001028298
- refseq_peptide: NP_001036029
Click on [?] for more information.