PYCARD (Mus musculus)
Description [+]
- Synonyms: PYCARD
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: PYD and CARD domain containing Gene [Source:MGI (curated);Acc:Pycard-001]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: PYCARD-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | PAAD_DAPIN | 4 | 87 |
PFAM A | CARD | 110 | 193 |
Protein sequence [+]
Pycard | Mus musculus | 10090 | length:193
MGRARDAILDALENLSGDELKKFKMKLLTVQLREGYGRIPRGALLQMDAIDLTDKLVSYY
LESYGLELTMTVLRDMGLQELAEQLQTTKEESGAVAAAASVPAQSTARTGHFVDQHRQAL
IARVTEVDGVLDALHGSVLTEGQYQAVRAETTSQDKMRKLFSFVPSWNLTCKDSLLQALK
EIHPYLVMDLEQS
LESYGLELTMTVLRDMGLQELAEQLQTTKEESGAVAAAASVPAQSTARTGHFVDQHRQAL
IARVTEVDGVLDALHGSVLTEGQYQAVRAETTSQDKMRKLFSFVPSWNLTCKDSLLQALK
EIHPYLVMDLEQS
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IMP |
GO:0006954 | inflammatory response | biological_proccess | IMP |
GO:0045786 | negative regulation of cell cycle | biological_proccess | IEA |
GO:0050718 | positive regulation of interleukin-1 beta secretion | biological_proccess | ISS |
GO:0006917 | induction of apoptosis | biological_proccess | ISO |
GO:0042981 | regulation of apoptosis | biological_proccess | IMP |
GO:0043281 | regulation of caspase activity | biological_proccess | IMP |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0007049 | cell cycle | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0032090 | Pyrin domain binding | mollecular_function | ISS |
GO:0042803 | protein homodimerization activity | mollecular_function | ISS |
GO:0016505 | apoptotic protease activator activity | mollecular_function | ISO |
GO:0005576 | extracellular region | cell_component | IDA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | ISS |
GO:0005829 | cytosol | cell_component | IDA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:1931465
- Ensembl genome browser [?] : ENSMUSG00000030793
- Expression info from Arrayexpress [?] : ENSMUSG00000030793
- Protein expression from Protein Atlas: [?] ENSMUSG00000030793
- Community gene edition from Wikigenes: [?] 66824
Click on [?] for more information.