BCL2L10 (Mus musculus)
Description [+]
- Synonyms: BCL2L10, BCL2L10, BCL2-LIKE 10, BOO, DIVA
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: Bcl2-like 10 Gene [Source:MGI Symbol;Acc:MGI:1330841]
- Family: Bcl-2 family : multidomain Bcl-2
- Process: undefined,
- Pathways: undefined,
- Criteria: manually curated
- Curator comment: The role of this protein during cell death requires further clarification.
- Human ortholog(s): BCL2L10
- WIKI: BCL2L10-M_musculus
References [+]
- Boo, a novel negative regulator of cell death, interacts with Apaf-1.
- Song Q, Kuang Y, Dixit VM, Vincenz C
- In this report, we describe the cloning and characterization of Boo, a novel anti-apoptotic member of the Bcl-2 family. The expression of Boo was highly restricted to the ovary and epididymis implicating it in the control of ovarian atresia and sperm maturation. Boo contains the conserved BH1 and BH2 domains, but lacks the BH3 motif. Like Bcl-2, Boo possesses a hydrophobic C-terminus and localizes to intracellular membranes. Boo also has an N-terminal region with strong homology to the BH4 domain found to be important for the function of some anti-apoptotic Bcl-2 homologues. Chromosomal localization analysis assigned Boo to murine chromosome 9 at band d9. Boo inhibits apoptosis, homodimerizes or heterodimerizes with some death-promoting and -suppressing Bcl-2 family members. More importantly, Boo interacts with Apaf-1 and forms a multimeric protein complex with Apaf-1 and caspase-9. Bak and Bik, two pro-apoptotic homologues disrupt the association of Boo and Apaf-1. Furthermore, Boo binds to three distinct regions of Apaf-1. These results demonstrate the evolutionarily conserved nature of the mechanisms of apoptosis. Like Ced-9, the mammalian homologues Boo and Bcl-xL interact with the human counterpart of Ced-4, Apaf-1, and thereby regulate apoptosis. EMBO J. 1999 Jan 4;18(1):167-78.
- Murine ovarian development is not affected by inactivation of the bcl-2 family member diva.
- Russell HR, Lee Y, Miller HL, Zhao J, McKinnon PJ
- Diva (also called Boo/Bcl-B) is a member of the Bcl-2 gene family and most likely functions during apoptosis. Diva is highly expressed in the ovary, and both pro- and antiapoptotic functions have been ascribed to this protein. To determine the role of Diva during murine development, we used gene targeting to inactivate DIVA: The Diva-null mice are born at the expected ratios, are fertile, and have no obvious histological abnormalities, and long-term survival did not differ from littermate controls. Additionally, Diva was not required for apoptosis occurring from genotoxic insult in the ovaries or other organs. Thus, Diva is not critical for the normal development of the ovaries, or in its absence its function is subserved by another protein. Mol Cell Biol. 2002 Oct;22(19):6866-70.
- References from Human ortholog(s):
- Boo, a novel negative regulator of cell death, interacts with Apaf-1.
- Song Q, Kuang Y, Dixit VM, Vincenz C
- In this report, we describe the cloning and characterization of Boo, a novel anti-apoptotic member of the Bcl-2 family. The expression of Boo was highly restricted to the ovary and epididymis implicating it in the control of ovarian atresia and sperm maturation. Boo contains the conserved BH1 and BH2 domains, but lacks the BH3 motif. Like Bcl-2, Boo possesses a hydrophobic C-terminus and localizes to intracellular membranes. Boo also has an N-terminal region with strong homology to the BH4 domain found to be important for the function of some anti-apoptotic Bcl-2 homologues. Chromosomal localization analysis assigned Boo to murine chromosome 9 at band d9. Boo inhibits apoptosis, homodimerizes or heterodimerizes with some death-promoting and -suppressing Bcl-2 family members. More importantly, Boo interacts with Apaf-1 and forms a multimeric protein complex with Apaf-1 and caspase-9. Bak and Bik, two pro-apoptotic homologues disrupt the association of Boo and Apaf-1. Furthermore, Boo binds to three distinct regions of Apaf-1. These results demonstrate the evolutionarily conserved nature of the mechanisms of apoptosis. Like Ced-9, the mammalian homologues Boo and Bcl-xL interact with the human counterpart of Ced-4, Apaf-1, and thereby regulate apoptosis. EMBO J. 1999 Jan 4;18(1):167-78.
- Diva, a Bcl-2 homologue that binds directly to Apaf-1 and induces BH3-independent cell death.
- Inohara N, Gourley TS, Carrio R, Muniz M, Merino J, Garcia I, Koseki T, Hu Y, Chen S, Nunez G
- We have identified and characterized Diva, which is a novel regulator of apoptosis. Sequence analysis revealed that Diva is a member of the Bcl-2 family of proteins containing Bcl-2 homology domain 1, 2, 3, and 4 (BH1, BH2, BH3, and BH4) regions and a carboxyl-terminal hydrophobic domain. The expression of Diva mRNA was detected in multiple embryonic tissues but was restricted to the ovary and testis in adult mice. The expression of Diva promoted the death of 293T, Ramsey, and T47D cells as well as that of primary sensory neurons, indicating that Diva is a proapoptotic protein. Significantly, Diva lacks critical residues in the conserved BH3 region that mediate the interaction between BH3-containing proapoptotic Bcl-2 homologues and their prosurvival binding partners. Consistent with this, Diva did not bind to cellular Bcl-2 family members including Bcl-2, Bcl-XL, Bcl-w, Mcl-1, and A1/Bfl-1. Furthermore, mutants of Diva lacking the BH3 region fully retained their proapoptotic activity, confirming that Diva promotes apoptosis in a BH3-independent manner. Significantly, Diva interacted with a viral Bcl-2 homologue (vBcl-2) encoded by the Kaposi's sarcoma-associated herpesvirus. Consistent with these associations, apoptosis induced by Diva was inhibited by vBcl-2 but not by Bcl-XL. Importantly, Diva interacted with Apaf-1, an adapter molecule that activates caspase-9, a central death protease of the apoptotic pathway. The expression of Diva inhibited the binding of Bcl-XL to Apaf-1, as determined by immunoprecipitation assays. Thus, Diva represents a novel type of proapoptotic Bcl-2 homologue that promotes apoptosis independently of the BH3 region through direct binding to Apaf-1, thus preventing Bcl-XL from binding to the caspase-9 regulator Apaf-1. J Biol Chem. 1998 Dec 4;273(49):32479-86.
Structure & Sequence [+]
Protein sequence [+]
Bcl2l10 | Mus musculus | 10090 | length:191
MADSQDPLHERTRRLLSDYIFFCAREPDTPEPPPTSVEAALLRSVTRQIQQEHQEFFSSF
CESRGNRLELVKQMADKLLSKDQDFSWSQLVMLLAFAGTLMNQGPYMAVKQKRDLGNRVI
VTRDCCLIVNFLYNLLMGRRHRARLEALGGWDGFCRFFKNPLPLGFWRRLLIQAFLSGFF
ATAIFFIWKRL
CESRGNRLELVKQMADKLLSKDQDFSWSQLVMLLAFAGTLMNQGPYMAVKQKRDLGNRVI
VTRDCCLIVNFLYNLLMGRRHRARLEALGGWDGFCRFFKNPLPLGFWRRLLIQAFLSGFF
ATAIFFIWKRL
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
BCL2L10 | orthology | Chimpanzee |
IPI00718256.3 | orthology | Cow |
IPI00824520.1 | orthology | Cow |
BCL2L10 | orthology | Gorilla |
BCL2L10 | orthology | Human |
BCL2L10 | orthology | Macaca |
O_latipes_ENSORLP00000015978 | orthology | Medaka |
M_domestica_ENSMODP00000002377 | orthology | Monodelphis |
BCL2L10 | orthology | Orangutan |
BCL2L10 | orthology | Rabbit |
Bcl2l10 | orthology | Rat |
D_rerio_ENSDARP00000037180 | orthology | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006916 | anti-apoptosis | biological_proccess | IDA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IDA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0031965 | nuclear membrane | cell_component | IEA |
GO:0005624 | membrane fraction | cell_component | ISO |
GO:0005829 | cytosol | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:1330841
- Ensembl genome browser [?] : ENSMUSG00000032191
- Expression info from Arrayexpress [?] : ENSMUSG00000032191
- Protein expression from Protein Atlas: [?] ENSMUSG00000032191
- Community gene edition from Wikigenes: [?] 12049
Click on [?] for more information.