ANXA2 (Mus musculus)
Description [+]
- Synonyms: ANXA2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: Annexin A2 (Annexin-2)(Annexin II)(Lipocortin II)(Calpactin I heavy chain)(Chromobindin-8)(p36)(Protein I)(Placental anticoagulant protein IV)(PAP-IV) [Source:UniProtKB/Swiss-Prot;Acc:P07356]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: ANXA2-M_musculus
Structure & Sequence [+]
Protein sequence [+]
Anxa2 | Mus musculus | 10090 | length:339
MSTVHEILCKLSLEGDHSTPPSAYGSVKPYTNFDAERDALNIETAVKTKGVDEVTIVNIL
TNRSNVQRQDIAFAYQRRTKKELPSALKSALSGHLETVILGLLKTPAQYDASELKASMKG
LGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRA
EDGSVIDYELIDQDARELYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERYKSYSPYDM
LESIKKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDM
LKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD
TNRSNVQRQDIAFAYQRRTKKELPSALKSALSGHLETVILGLLKTPAQYDASELKASMKG
LGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRA
EDGSVIDYELIDQDARELYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERYKSYSPYDM
LESIKKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDM
LKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001525 | angiogenesis | biological_proccess | IMP |
GO:0030199 | collagen fibril organization | biological_proccess | IMP |
GO:0042730 | fibrinolysis | biological_proccess | IMP |
GO:0050819 | negative regulation of coagulation | biological_proccess | IEA |
GO:0007589 | body fluid secretion | biological_proccess | IEA |
GO:0004859 | phospholipase inhibitor activity | mollecular_function | IEA |
GO:0005509 | calcium ion binding | mollecular_function | IEA |
GO:0005544 | calcium-dependent phospholipid binding | mollecular_function | IEA |
GO:0008092 | cytoskeletal protein binding | mollecular_function | IEA |
GO:0005546 | phosphatidylinositol-4,5-bisphosphate binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | ISS |
GO:0017137 | Rab GTPase binding | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IDA |
GO:0005769 | early endosome | cell_component | IDA |
GO:0042383 | sarcolemma | cell_component | IDA |
GO:0043234 | protein complex | cell_component | IEA |
GO:0048471 | perinuclear region of cytoplasm | cell_component | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005604 | basement membrane | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0042470 | melanosome | cell_component | IEA |
GO:0001725 | stress fiber | cell_component | ISS |
GO:0005578 | proteinaceous extracellular matrix | cell_component | IEA |
GO:0005624 | membrane fraction | cell_component | ISS |
GO:0030054 | cell junction | cell_component | ISS |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSMUSG00000032231
- Expression info from Arrayexpress [?] : ENSMUSG00000032231
- Protein expression from Protein Atlas: [?] ENSMUSG00000032231
Click on [?] for more information.