LYN (Mus musculus)
Description [+]
- Synonyms: LYN
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: Yamaguchi sarcoma viral (v-yes-1) oncogene homolog Gene [Source:MGI (curated);Acc:Lyn-001]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: LYN-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | SH3_1 | 66 | 121 |
PFAM A | SH3_2 | 67 | 121 |
PFAM A | SH2 | 129 | 211 |
PFAM A | Pkinase | 247 | 500 |
PFAM A | Pkinase_Tyr | 247 | 497 |
Protein sequence [+]
Lyn | Mus musculus | 10090 | length:512
MGCIKSKRKDNLNDDEVDSKTQPVRNTDRTIYVRDPTSNKQQRPVPEFHLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSSKREGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDYDPMHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKKLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTKEEPIYIITEFMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMSALSQGYRMPRMENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSSKREGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDYDPMHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKKLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTKEEPIYIITEFMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMSALSQGYRMPRMENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
Structure links:
- Smartdomain prediction information: SM00326
- Smartdomain prediction information: SM00252
- Smartdomain prediction information: SM00219
- Smartdomain prediction information: SM00220
- Prosite motif and domain information: PS00107
- Prosite motif and domain information: PS00109
- Interpro domain information: P25911
- PFAM domain and domain family information: P25911
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007242 | intracellular signaling cascade | biological_proccess | IDA |
GO:0018108 | peptidyl-tyrosine phosphorylation | biological_proccess | IDA |
GO:0046777 | protein amino acid autophosphorylation | biological_proccess | TAS |
GO:0050853 | B cell receptor signaling pathway | biological_proccess | IDA |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IMP |
GO:0009725 | response to hormone stimulus | biological_proccess | IDA |
GO:0030218 | erythrocyte differentiation | biological_proccess | IMP |
GO:0042531 | positive regulation of tyrosine phosphorylation of STAT protein | biological_proccess | IMP |
GO:0042541 | hemoglobin biosynthetic process | biological_proccess | TAS |
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0009743 | response to carbohydrate stimulus | biological_proccess | IEA |
GO:0014070 | response to organic cyclic substance | biological_proccess | IEA |
GO:0042493 | response to drug | biological_proccess | IEA |
GO:0043200 | response to amino acid stimulus | biological_proccess | IEA |
GO:0051789 | response to protein stimulus | biological_proccess | IEA |
GO:0009636 | response to toxin | biological_proccess | IEA |
GO:0031668 | cellular response to extracellular stimulus | biological_proccess | IEA |
GO:0002553 | histamine secretion by mast cell | biological_proccess | IEA |
GO:0032868 | response to insulin stimulus | biological_proccess | IEA |
GO:0060252 | positive regulation of glial cell proliferation | biological_proccess | IEA |
GO:0048678 | response to axon injury | biological_proccess | IEA |
GO:0042327 | positive regulation of phosphorylation | biological_proccess | IEA |
GO:0050663 | cytokine secretion | biological_proccess | IEA |
GO:0051279 | regulation of release of sequestered calcium ion into cytosol | biological_proccess | IEA |
GO:0034605 | cellular response to heat | biological_proccess | IEA |
GO:0014003 | oligodendrocyte development | biological_proccess | IEA |
GO:0006991 | response to sterol depletion | biological_proccess | IEA |
GO:0060369 | positive regulation of Fc receptor mediated stimulatory signaling pathway | biological_proccess | IEA |
GO:0070447 | positive regulation of oligodendrocyte progenitor proliferation | biological_proccess | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IDA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0004715 | non-membrane spanning protein tyrosine kinase activity | mollecular_function | IEA |
GO:0005128 | erythropoietin receptor binding | mollecular_function | TAS |
GO:0016301 | kinase activity | mollecular_function | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IDA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0031625 | ubiquitin protein ligase binding | mollecular_function | IEA |
GO:0051219 | phosphoprotein binding | mollecular_function | IEA |
GO:0005161 | platelet-derived growth factor receptor binding | mollecular_function | IEA |
GO:0005178 | integrin binding | mollecular_function | IEA |
GO:0043208 | glycosphingolipid binding | mollecular_function | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IDA |
GO:0005737 | cytoplasm | cell_component | IDA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0014069 | postsynaptic density | cell_component | IEA |
GO:0005624 | membrane fraction | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
GO:0045121 | membrane raft | cell_component | IEA |
GO:0005758 | mitochondrial intermembrane space | cell_component | IEA |
GO:0030061 | mitochondrial crista | cell_component | IEA |
GO:0034666 | alpha2-beta1 integrin complex | cell_component | IEA |
GO:0005794 | Golgi apparatus | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from MGI [?] MGI:96892
- Ensembl genome browser [?] : ENSMUSG00000042228
- Expression info from Arrayexpress [?] : ENSMUSG00000042228
- Protein expression from Protein Atlas: [?] ENSMUSG00000042228
- Community gene edition from Wikigenes: [?] 17096
- entrezgene: 17096
- refseq_dna: NM_001111096
- refseq_dna: NM_010747
- refseq_peptide: NP_001104566
- refseq_peptide: NP_034877
Click on [?] for more information.