MOAP1 (Mus musculus)
Description [+]
- Synonyms: MOAP1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: modulator of apoptosis 1 Gene [Source:MGI Symbol;Acc:MGI:1915555]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: MOAP1-M_musculus
Structure & Sequence [+]
Protein sequence [+]
Moap1 | Mus musculus | 10090 | length:352
MTLRLLEDWCRGMDMNPRKALLVAGIPPTCGVADIEEALQAGLAPLGEHRLLGRMFRRDE
NKNVALIGLTVETGSALVPKEIPAKGGVWRVIFKPPDTDSDFLCRLNEFLKGEGMTMGEL
TRVLGNRNDPLGLDPGIMIPEIRAPMLAQALNEALKPTLQYLRYKKLSVFSGRDPPGPGE
EEFESWMFHTSQVMKTWQVSDVEKRRRLIESLRGPAFEIIRVLKINNPFITVAECLKTLE
TIFGIIDNPRALQVKYLTTYQKTDEKLSAYVLRLEPLLQKLVQKGAIEKEVVNQARLDQV
IAGAVHKSVRRELGLPEGSPAPGLLQLLTLIKDKEAEEEEVLLQAELEGYCT
NKNVALIGLTVETGSALVPKEIPAKGGVWRVIFKPPDTDSDFLCRLNEFLKGEGMTMGEL
TRVLGNRNDPLGLDPGIMIPEIRAPMLAQALNEALKPTLQYLRYKKLSVFSGRDPPGPGE
EEFESWMFHTSQVMKTWQVSDVEKRRRLIESLRGPAFEIIRVLKINNPFITVAECLKTLE
TIFGIIDNPRALQVKYLTTYQKTDEKLSAYVLRLEPLLQKLVQKGAIEKEVVNQARLDQV
IAGAVHKSVRRELGLPEGSPAPGLLQLLTLIKDKEAEEEEVLLQAELEGYCT
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0042981 | regulation of apoptosis | biological_proccess | RCA |
GO:0006915 | apoptosis | biological_proccess | RCA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0006921 | cell structure disassembly during apoptosis | biological_proccess | IEA |
GO:0030262 | apoptotic nuclear changes | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | ISO |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0042803 | protein homodimerization activity | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | ISO |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:1915555
- Ensembl genome browser [?] : ENSMUSG00000041716
- Expression info from Arrayexpress [?] : ENSMUSG00000041716
- Protein expression from Protein Atlas: [?] ENSMUSG00000041716
- Community gene edition from Wikigenes: [?] 64113
- entrezgene: 64113
- refseq_dna: NM_022323
- refseq_dna: NM_001142937
- refseq_peptide: NP_071718
- refseq_peptide: NP_001136409
Click on [?] for more information.