GAPDH (Mus musculus)
Description [+]
- Synonyms: GAPDH
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: glyceraldehyde-3-phosphate dehydrogenase Gene [Source:MGI (curated);Acc:Gapdh-003]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: GAPDH-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Gp_dh_N | 6 | 154 |
PFAM A | Gp_dh_C | 159 | 316 |
Protein sequence [+]
Gapdh | Mus musculus | 10090 | length:337
PVDKMVKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNG
TVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKR
VIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTV
HAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTP
NVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAG
AGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE
TVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKR
VIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTV
HAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTP
NVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAG
AGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006006 | glucose metabolic process | biological_proccess | IEA |
GO:0008152 | metabolic process | biological_proccess | IEA |
GO:0007275 | multicellular organismal development | biological_proccess | IMP |
GO:0006096 | glycolysis | biological_proccess | IEA |
GO:0055114 | oxidation reduction | biological_proccess | IEA |
GO:0003824 | catalytic activity | mollecular_function | IEA |
GO:0004365 | glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) activity | mollecular_function | IEA |
GO:0005488 | binding | mollecular_function | IEA |
GO:0051287 | NAD or NADH binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
GO:0008943 | glyceraldehyde-3-phosphate dehydrogenase activity | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IDA |
GO:0005739 | mitochondrion | cell_component | IDA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:95640
- Ensembl genome browser [?] : ENSMUSG00000057666
- Expression info from Arrayexpress [?] : ENSMUSG00000057666
- Protein expression from Protein Atlas: [?] ENSMUSG00000057666
- Community gene edition from Wikigenes: [?] 100046067
- entrezgene: 14433
- entrezgene: 545741
- entrezgene: 666342
- entrezgene: 676923
- entrezgene: 100039229
- entrezgene: 100040053
- entrezgene: 100040898
- entrezgene: 100041236
- entrezgene: 100041325
- entrezgene: 100041342
- entrezgene: 100041399
- entrezgene: 100041831
- entrezgene: 100042025
- entrezgene: 100042349
- entrezgene: 100042746
- entrezgene: 100043349
- entrezgene: 100043839
- entrezgene: 100044724
- entrezgene: 100044981
- entrezgene: 100046806
- entrezgene: 100047352
- entrezgene: 100048117
- entrezgene: 100048291
- entrezgene: 100045141
- entrezgene: 100048438
- entrezgene: 100046067
- entrezgene: 675602
- refseq_peptide: NP_032110
Click on [?] for more information.