GAPDHS (Mus musculus)
Description [+]
- Synonyms: GAPDHS
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: glyceraldehyde-3-phosphate dehydrogenase, spermatogenic Gene [Source:MGI Symbol;Acc:MGI:95653]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: GAPDHS-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Gp_dh_N | 108 | 256 |
PFAM A | Gp_dh_C | 261 | 418 |
Protein sequence [+]
Gapdhs | Mus musculus | 10090 | length:440
MSRRDVVLTNVTVVQLRRDRCPCPCPCPCPCPCPVIRPPPPKVEDPPPTVEEQPPPPPPP
PPPPPPPPPPPPPQIEPDKFEEAPPPPPPPPPPPPPPPPPLQKPARELTVGINGFGRIGR
LVLRVCMEKGIRVVAVNDPFIDPEYMVYMFKYDSTHGRYKGNVEHKNGQLVVDNLEINTY
QCKDPKEIPWSSIGNPYVVECTGVYLSIEAASAHISSGARRVVVTAPSPDAPMFVMGVNE
KDYNPGSMTIVSNASCTTNCLAPLAKVIHENFGIVEGLMTTVHSYTATQKTVDGPSKKDW
RGGRGAHQNIIPSSTGAAKAVGKVIPELKGKLTGMAFRVPTPNVSVVDLTCRLAKPASYS
AITEAVKAAAKGPLAGILAYTEDQVVSTDFNGNPHSSIFDAKAGIALNDNFVKLVAWYDN
EYGYSNRVVDLLRYMFSREK
PPPPPPPPPPPPPQIEPDKFEEAPPPPPPPPPPPPPPPPPLQKPARELTVGINGFGRIGR
LVLRVCMEKGIRVVAVNDPFIDPEYMVYMFKYDSTHGRYKGNVEHKNGQLVVDNLEINTY
QCKDPKEIPWSSIGNPYVVECTGVYLSIEAASAHISSGARRVVVTAPSPDAPMFVMGVNE
KDYNPGSMTIVSNASCTTNCLAPLAKVIHENFGIVEGLMTTVHSYTATQKTVDGPSKKDW
RGGRGAHQNIIPSSTGAAKAVGKVIPELKGKLTGMAFRVPTPNVSVVDLTCRLAKPASYS
AITEAVKAAAKGPLAGILAYTEDQVVSTDFNGNPHSSIFDAKAGIALNDNFVKLVAWYDN
EYGYSNRVVDLLRYMFSREK
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006006 | glucose metabolic process | biological_proccess | IEA |
GO:0006096 | glycolysis | biological_proccess | IEA |
GO:0055114 | oxidation reduction | biological_proccess | IEA |
GO:0007186 | G-protein coupled receptor protein signaling pathway | biological_proccess | IEA |
GO:0008152 | metabolic process | biological_proccess | IEA |
GO:0007155 | cell adhesion | biological_proccess | IEA |
GO:0030317 | sperm motility | biological_proccess | IDA |
GO:0045821 | positive regulation of glycolysis | biological_proccess | TAS |
GO:0007286 | spermatid development | biological_proccess | IEA |
GO:0004365 | glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) activity | mollecular_function | IEA |
GO:0005488 | binding | mollecular_function | IEA |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
GO:0051287 | NAD or NADH binding | mollecular_function | IEA |
GO:0005179 | hormone activity | mollecular_function | IEA |
GO:0005199 | structural constituent of cell wall | mollecular_function | IEA |
GO:0008943 | glyceraldehyde-3-phosphate dehydrogenase activity | mollecular_function | IEA |
GO:0003824 | catalytic activity | mollecular_function | IEA |
GO:0005198 | structural molecule activity | mollecular_function | IEA |
GO:0008943 | glyceraldehyde-3-phosphate dehydrogenase activity | mollecular_function | IDA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0009434 | microtubule-based flagellum | cell_component | IDA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0015629 | actin cytoskeleton | cell_component | IEA |
GO:0019861 | flagellum | cell_component | IDA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:95653
- Ensembl genome browser [?] : ENSMUSG00000061099
- Expression info from Arrayexpress [?] : ENSMUSG00000061099
- Protein expression from Protein Atlas: [?] ENSMUSG00000061099
- Community gene edition from Wikigenes: [?] 14447
Click on [?] for more information.