CYCS (Mus musculus)
Description [+]
- Synonyms: CYCS, CYCS, CYTOCHROME C, SOMATIC
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: Cytochrome c, somatic [Source:UniProtKB/Swiss-Prot;Acc:P62897]
- Family: other
- Process: apoptosis,
- Pathways: extrinsic pathway, intrinsic pathway, post-mitochondrial caspase activation,
- Criteria: manually curated
- Curator comment:
- WIKI: CYCS-M_musculus
References [+]
- Specific ablation of the apoptotic functions of cytochrome C reveals a differential requirement for cytochrome C and Apaf-1 in apoptosis.
- Hao Z, Duncan GS, Chang CC, Elia A, Fang M, Wakeham A, Okada H, Calzascia T, Jang Y, You-Ten A, Yeh WC, Ohashi P, Wang X, Mak TW
- As components of the apoptosome, a caspase-activating complex, cytochrome c (Cyt c) and Apaf-1 are thought to play critical roles during apoptosis. Due to the obligate function of Cyt c in electron transport, its requirement for apoptosis in animals has been difficult to establish. We generated knockin mice expressing a mutant Cyt c (KA allele), which retains normal electron transfer function but fails to activate Apaf-1. Most KA/KA mice displayed embryonic or perinatal lethality caused by defects in the central nervous system, and surviving mice exhibited impaired lymphocyte homeostasis. Although fibroblasts from the KA/KA mice were resistant to apoptosis, their thymocytes were markedly more sensitive to death stimuli than Apaf-1(-/-) thymocytes. Upon treatment with gamma irradiation, procaspases were efficiently activated in apoptotic KA/KA thymocytes, but Apaf-1 oligomerization was not observed. These studies indicate the existence of a Cyt c- and apoptosome-independent but Apaf-1-dependent mechanism(s) for caspase activation. Cell. 2005 May 20;121(4):579-91.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Cytochrom_C | 4 | 103 |
Protein sequence [+]
Cycs | Mus musculus | 10090 | length:105
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006810 | transport | biological_proccess | IEA |
GO:0008635 | activation of caspase activity by cytochrome c | biological_proccess | IMP |
GO:0022900 | electron transport chain | biological_proccess | IEA |
GO:0042743 | hydrogen peroxide metabolic process | biological_proccess | IDA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IDA |
GO:0006915 | apoptosis | biological_proccess | IDA |
GO:0009055 | electron carrier activity | mollecular_function | IEA |
GO:0020037 | heme binding | mollecular_function | IEA |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0005506 | iron ion binding | mollecular_function | IEA |
GO:0005625 | soluble fraction | cell_component | IDA |
GO:0005739 | mitochondrion | cell_component | IDA |
GO:0005759 | mitochondrial matrix | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IDA |
GO:0070469 | respiratory chain | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from MGI [?] MGI:88578
- Ensembl genome browser [?] : ENSMUSG00000063694
- Expression info from Arrayexpress [?] : ENSMUSG00000063694
- Protein expression from Protein Atlas: [?] ENSMUSG00000063694
- Community gene edition from Wikigenes: [?] 100045925
Click on [?] for more information.