BMF (Mus musculus)
Description [+]
- Synonyms: BMF, BMF, BCL2 MODIFYING FACTOR
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: BCL2 modifying factor Gene [Source:MGI (curated);Acc:Bmf-001]
- Family: Bcl-2 family : BH3-only
- Process: apoptosis, necroptosis,
- Pathways: intrinsic pathway, pre-mitochondrial signaling events,
- Criteria: manually curated
- Curator comment:
- Human ortholog(s): BMF
- WIKI: BMF-M_musculus
References [+]
- Identification of a molecular signaling network that regulates a cellular necrotic cell death pathway.
- Hitomi J, Christofferson DE, Ng A, Yao J, Degterev A, Xavier RJ, Yuan J
- Stimulation of death receptors by agonists such as FasL and TNFalpha activates apoptotic cell death in apoptotic-competent conditions or a type of necrotic cell death dependent on RIP1 kinase, termed necroptosis, in apoptotic-deficient conditions. In a genome-wide siRNA screen for regulators of necroptosis, we identify a set of 432 genes that regulate necroptosis, a subset of 32 genes that act downstream and/or as regulators of RIP1 kinase, 32 genes required for death-receptor-mediated apoptosis, and 7 genes involved in both necroptosis and apoptosis. We show that the expression of subsets of the 432 genes is enriched in the immune and nervous systems, and cellular sensitivity to necroptosis is regulated by an extensive signaling network mediating innate immunity. Interestingly, Bmf, a BH3-only Bcl-2 family member, is required for death-receptor-induced necroptosis. Our study defines a cellular signaling network that regulates necroptosis and the molecular bifurcation that controls apoptosis and necroptosis. Cell. 2008 Dec 26;135(7):1311-23.
- Bmf: a proapoptotic BH3-only protein regulated by interaction with the myosin V actin motor complex, activated by anoikis.
- Puthalakath H, Villunger A, O'Reilly LA, Beaumont JG, Coultas L, Cheney RE, Huang DC, Strasser A
- Bcl-2 family members bearing only the BH3 domain are essential inducers of apoptosis. We identified a BH3-only protein, Bmf, and show that its BH3 domain is required both for binding to prosurvival Bcl-2 proteins and for triggering apoptosis. In healthy cells, Bmf is sequestered to myosin V motors by association with dynein light chain 2. Certain damage signals, such as loss of cell attachment (anoikis), unleash Bmf, allowing it to translocate and bind prosurvival Bcl-2 proteins. Thus, at least two mammalian BH3-only proteins, Bmf and Bim, function to sense intracellular damage by their localization to distinct cytoskeletal structures. Science. 2001 Sep 7;293(5536):1829-32.
- References from Human ortholog(s):
- Bmf: a proapoptotic BH3-only protein regulated by interaction with the myosin V actin motor complex, activated by anoikis.
- Puthalakath H, Villunger A, O'Reilly LA, Beaumont JG, Coultas L, Cheney RE, Huang DC, Strasser A
- Bcl-2 family members bearing only the BH3 domain are essential inducers of apoptosis. We identified a BH3-only protein, Bmf, and show that its BH3 domain is required both for binding to prosurvival Bcl-2 proteins and for triggering apoptosis. In healthy cells, Bmf is sequestered to myosin V motors by association with dynein light chain 2. Certain damage signals, such as loss of cell attachment (anoikis), unleash Bmf, allowing it to translocate and bind prosurvival Bcl-2 proteins. Thus, at least two mammalian BH3-only proteins, Bmf and Bim, function to sense intracellular damage by their localization to distinct cytoskeletal structures. Science. 2001 Sep 7;293(5536):1829-32.
- Identification of a molecular signaling network that regulates a cellular necrotic cell death pathway.
- Hitomi J, Christofferson DE, Ng A, Yao J, Degterev A, Xavier RJ, Yuan J
- Stimulation of death receptors by agonists such as FasL and TNFalpha activates apoptotic cell death in apoptotic-competent conditions or a type of necrotic cell death dependent on RIP1 kinase, termed necroptosis, in apoptotic-deficient conditions. In a genome-wide siRNA screen for regulators of necroptosis, we identify a set of 432 genes that regulate necroptosis, a subset of 32 genes that act downstream and/or as regulators of RIP1 kinase, 32 genes required for death-receptor-mediated apoptosis, and 7 genes involved in both necroptosis and apoptosis. We show that the expression of subsets of the 432 genes is enriched in the immune and nervous systems, and cellular sensitivity to necroptosis is regulated by an extensive signaling network mediating innate immunity. Interestingly, Bmf, a BH3-only Bcl-2 family member, is required for death-receptor-induced necroptosis. Our study defines a cellular signaling network that regulates necroptosis and the molecular bifurcation that controls apoptosis and necroptosis. Cell. 2008 Dec 26;135(7):1311-23.
Structure & Sequence [+]
Protein sequence [+]
Bmf | Mus musculus | 10090 | length:271
MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPIECGHQAPRVF
FTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADL
FAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQR
LFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQ
QNRDRAWWQVFLFLQNLALNRQENREGVGPW
FTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADL
FAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQR
LFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQ
QNRDRAWWQVFLFLQNLALNRQENREGVGPW
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
BMF | orthology | Chicken |
XR_023049.1 | orthology | Chimpanzee |
NP_001070953.1 | orthology | Cow |
BMF | orthology | Dog |
BMF | orthology | Gorilla |
BMF | orthology | Horse |
BMF | orthology | Human |
BMF | orthology | Lyzard |
BMF | orthology | Macaca |
BMF | orthology | Monodelphis |
BMF | orthology | Orangutan |
BMF | orthology | Rabbit |
Bmf | orthology | Rat |
BMF | orthology | Xenopus |
BMF | orthology | Zebra finch |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0042981 | regulation of apoptosis | biological_proccess | IDA |
GO:0006915 | apoptosis | biological_proccess | IDA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IDA |
GO:0015629 | actin cytoskeleton | cell_component | IDA |
Check GO Evidence Codes here
Curated Isoforms [+]
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from MGI [?] MGI:2176433
- Ensembl genome browser [?] : ENSMUSG00000040093
- Expression info from Arrayexpress [?] : ENSMUSG00000040093
- Protein expression from Protein Atlas: [?] ENSMUSG00000040093
- Community gene edition from Wikigenes: [?] 171543
Click on [?] for more information.