TRP73 (Mus musculus)
Description [+]
- Synonyms: TRP73
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: transformation related protein 73 Gene [Source:MGI (curated);Acc:Trp73-001]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TRP73-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | P53 | 112 | 308 |
PFAM A | P53_tetramer | 344 | 385 |
PFAM A | SAM_2 | 486 | 552 |
Protein sequence [+]
Trp73 | Mus musculus | 10090 | length:638
MSGSVGEMAQTSSSSSSTFEHLWSSLEPDSTYFDLPQPSQGTSEASGSEESNMDVFHLQG
MAQFNLLSSAMDQMGSRAAPASPYTPEHAASAPTHSPYAQPSSTFDTMSPAPVIPSNTDY
PGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVY
KKAEHVTDIVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLAQYVDDPVTGRQSVVVPYE
PPQVGTEFTTILYNFMCNSSCVGGMNRRPILVIITLETRDGQVLGRRSFEGRICACPGRD
RKADEDHYREQQALNESTTKNGAASKRAFKQSPPAIPALGTNVKKRRHGDEDMFYMHVRG
RENFEILMKVKESLELMELVPQPLVDSYRQQQQQQLLQRPSHLQPPSYGPVLSPMNKVHG
GVNKLPSVNQLVGQPPPHSSAAGPNLGPMGSGMLNSHGHSMPANGEMNGGHSSQTMVSGS
HCTPPPPYHADPSLVSFLTGLGCPNCIECFTSQGLQSIYHLQNLTIEDLGALKVPDQYRM
TIWRGLQDLKQSHDCGQQLLRSSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRG
GAGAVTGPDEWADFGFDLPDCKSRKQPIKEEFTETESH
MAQFNLLSSAMDQMGSRAAPASPYTPEHAASAPTHSPYAQPSSTFDTMSPAPVIPSNTDY
PGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVY
KKAEHVTDIVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLAQYVDDPVTGRQSVVVPYE
PPQVGTEFTTILYNFMCNSSCVGGMNRRPILVIITLETRDGQVLGRRSFEGRICACPGRD
RKADEDHYREQQALNESTTKNGAASKRAFKQSPPAIPALGTNVKKRRHGDEDMFYMHVRG
RENFEILMKVKESLELMELVPQPLVDSYRQQQQQQLLQRPSHLQPPSYGPVLSPMNKVHG
GVNKLPSVNQLVGQPPPHSSAAGPNLGPMGSGMLNSHGHSMPANGEMNGGHSSQTMVSGS
HCTPPPPYHADPSLVSFLTGLGCPNCIECFTSQGLQSIYHLQNLTIEDLGALKVPDQYRM
TIWRGLQDLKQSHDCGQQLLRSSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRG
GAGAVTGPDEWADFGFDLPDCKSRKQPIKEEFTETESH
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IDA |
GO:0002347 | response to tumor cell | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IMP |
GO:0006974 | response to DNA damage stimulus | biological_proccess | IMP |
GO:0007050 | cell cycle arrest | biological_proccess | IDA |
GO:0009791 | post-embryonic development | biological_proccess | IMP |
GO:0021766 | hippocampus development | biological_proccess | IMP |
GO:0030308 | negative regulation of cell growth | biological_proccess | IEA |
GO:0030900 | forebrain development | biological_proccess | IMP |
GO:0033326 | cerebrospinal fluid secretion | biological_proccess | IMP |
GO:0043508 | negative regulation of JUN kinase activity | biological_proccess | IDA |
GO:0043524 | negative regulation of neuron apoptosis | biological_proccess | IMP |
GO:0045786 | negative regulation of cell cycle | biological_proccess | IEA |
GO:0045793 | positive regulation of cell size | biological_proccess | IMP |
GO:0045893 | positive regulation of transcription, DNA-dependent | biological_proccess | IDA |
GO:0048546 | digestive tract morphogenesis | biological_proccess | IMP |
GO:0048666 | neuron development | biological_proccess | IMP |
GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0006350 | transcription | biological_proccess | IEA |
GO:0007049 | cell cycle | biological_proccess | IEA |
GO:0043523 | regulation of neuron apoptosis | biological_proccess | IGI |
GO:0006915 | apoptosis | biological_proccess | IDA |
GO:0042981 | regulation of apoptosis | biological_proccess | TAS |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IDA |
GO:0045449 | regulation of transcription | biological_proccess | IEA |
GO:0045893 | positive regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0043524 | negative regulation of neuron apoptosis | biological_proccess | IDA |
GO:0002039 | p53 binding | mollecular_function | IPI |
GO:0003700 | transcription factor activity | mollecular_function | IDA |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0003677 | DNA binding | mollecular_function | IDA |
GO:0005515 | protein binding | mollecular_function | TAS |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0003700 | transcription factor activity | mollecular_function | IEA |
GO:0003677 | DNA binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IDA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from MGI [?] MGI:1336991
- Ensembl genome browser [?] : ENSMUSG00000029026
- Expression info from Arrayexpress [?] : ENSMUSG00000029026
- Protein expression from Protein Atlas: [?] ENSMUSG00000029026
- Community gene edition from Wikigenes: [?] 22062
- entrezgene: 22062
- refseq_dna: NM_011642
- refseq_dna: NM_001126330
- refseq_dna: NM_001126331
- refseq_peptide: NP_035772
- refseq_peptide: NP_001119802
- refseq_peptide: NP_001119803
Click on [?] for more information.