TRP53 (Mus musculus)
Description [+]
- Synonyms: TRP53, TP53, P53, TUMOR SUPPRESSOR P53, TRP53, CELLULAR TUMOR ANTIGEN P53
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: transformation related protein 53 Gene [Source:MGI (curated);Acc:Trp53-001]
- Family: other
- Process: apoptosis,
- Pathways: intrinsic pathway, pre-mitochondrial signaling events,
- Criteria: manually curated
- Curator comment: Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type.
- WIKI: TRP53-M_musculus
References [+]
- Blinded by the Light: The Growing Complexity of p53.
- Vousden KH, Prives C
- While the tumor suppressor functions of p53 have long been recognized, the contribution of p53 to numerous other aspects of disease and normal life is only now being appreciated. This burgeoning range of responses to p53 is reflected by an increasing variety of mechanisms through which p53 can function, although the ability to activate transcription remains key to p53's modus operandi. Control of p53's transcriptional activity is crucial for determining which p53 response is activated, a decision we must understand if we are to exploit efficiently the next generation of drugs that selectively activate or inhibit p53. Cell. 2009 May 1;137(3):413-31.
- Hematopoietic cells from mice deficient in wild-type p53 are more resistant to induction of apoptosis by some agents.
- Lotem J, Sachs L
- Wild-type p53 is a tumor-suppressor gene that can induce cell death by apoptosis when expressed in myeloid leukemic and some other types of tumor cells. However, the question remained as to what extent wild-type p53 is a mediator of apoptosis in normal cells. We have used mice deficient in wild-type p53 to determine whether induction of apoptosis in hematopoietic cells from these p53 deficient mice is defective. We show here that bone marrow myeloid progenitor cells from p53-deficient mice are more resistant to induction of apoptosis when there was only a low concentration of the viability factors granulocyte-macrophage colony-stimulating factor; interleukins-1 alpha, -3, and -6; or stem cell factor; or when apoptosis was induced in these cells by irradiation or heat shock. The loss of one allele of wild-type p53 was sufficient for increased resistance. The higher resistance to apoptosis in p53-deficient mice was also found in irradiated thymocytes, but not in thymocytes treated with dexamethasone or in mature peritoneal granulocytes. The degree of resistance in irradiated myeloid progenitors and thymocytes showed a dosage effect of the number of wild-type p53 genes. The results show that wild-type p53 is involved in the induction of apoptosis by some agents in normal hematopoietic cells. Loss of wild-type p53 can, therefore, contribute to tumor development by decreasing cell death at low concentrations of viability factors and after exposure to a DNA-damaging agent. The results also show that there are wild-type p53-dependent and -independent pathways of normal cell apoptosis. Blood. 1993 Aug 15;82(4):1092-6.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | P53_TAD | 8 | 32 |
PFAM A | P53 | 92 | 286 |
PFAM A | P53_tetramer | 315 | 356 |
Protein sequence [+]
Trp53 | Mus musculus | 10090 | length:390
MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEA
LRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVM
CTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCS
DGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCM
GGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGS
AKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSR
AHSSYLKTKKGQSTSRHKKTMVKKVGPDSD
LRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVM
CTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCS
DGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCM
GGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGS
AKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSR
AHSSYLKTKKGQSTSRHKKTMVKKVGPDSD
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0000060 | protein import into nucleus, translocation | biological_proccess | IDA |
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | biological_proccess | IDA |
GO:0001701 | in utero embryonic development | biological_proccess | IGI |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IGI |
GO:0002309 | T cell proliferation during immune response | biological_proccess | IGI |
GO:0002326 | B cell lineage commitment | biological_proccess | IMP |
GO:0002347 | response to tumor cell | biological_proccess | IEA |
GO:0002360 | T cell lineage commitment | biological_proccess | IMP |
GO:0006302 | double-strand break repair | biological_proccess | IMP |
GO:0006917 | induction of apoptosis | biological_proccess | IMP |
GO:0006974 | response to DNA damage stimulus | biological_proccess | IMP |
GO:0007369 | gastrulation | biological_proccess | IGI |
GO:0007406 | negative regulation of neuroblast proliferation | biological_proccess | IGI |
GO:0007417 | central nervous system development | biological_proccess | IGI |
GO:0007569 | cell aging | biological_proccess | IGI |
GO:0008156 | negative regulation of DNA replication | biological_proccess | IDA |
GO:0009303 | rRNA transcription | biological_proccess | IGI |
GO:0009651 | response to salt stress | biological_proccess | IGI |
GO:0009792 | embryonic development ending in birth or egg hatching | biological_proccess | IGI |
GO:0010165 | response to X-ray | biological_proccess | IDA |
GO:0010332 | response to gamma radiation | biological_proccess | IMP |
GO:0030308 | negative regulation of cell growth | biological_proccess | IEA |
GO:0031571 | G1 DNA damage checkpoint | biological_proccess | IMP |
GO:0033077 | T cell differentiation in the thymus | biological_proccess | IGI |
GO:0034644 | cellular response to UV | biological_proccess | IGI |
GO:0042493 | response to drug | biological_proccess | IDA |
GO:0042771 | DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis | biological_proccess | IMP |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IMP |
GO:0043525 | positive regulation of neuron apoptosis | biological_proccess | IMP |
GO:0045786 | negative regulation of cell cycle | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IDA |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IGI |
GO:0048147 | negative regulation of fibroblast proliferation | biological_proccess | IMP |
GO:0051276 | chromosome organization | biological_proccess | IGI |
GO:0042149 | cellular response to glucose starvation | biological_proccess | ISO |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IGI |
GO:0042981 | regulation of apoptosis | biological_proccess | ISO |
GO:0043523 | regulation of neuron apoptosis | biological_proccess | IGI |
GO:0051726 | regulation of cell cycle | biological_proccess | IMP |
GO:0030330 | DNA damage response, signal transduction by p53 class mediator | biological_proccess | IGI |
GO:0006915 | apoptosis | biological_proccess | IGI |
GO:0009411 | response to UV | biological_proccess | IMP |
GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IDA |
GO:0045941 | positive regulation of transcription | biological_proccess | IDA |
GO:0018144 | RNA-protein covalent cross-linking | biological_proccess | IEA |
GO:0045893 | positive regulation of transcription, DNA-dependent | biological_proccess | IDA |
GO:0006350 | transcription | biological_proccess | IEA |
GO:0008285 | negative regulation of cell proliferation | biological_proccess | IGI |
GO:0006983 | ER overload response | biological_proccess | ISO |
GO:0007049 | cell cycle | biological_proccess | IEA |
GO:0042127 | regulation of cell proliferation | biological_proccess | IGI |
GO:0045449 | regulation of transcription | biological_proccess | IEA |
GO:0008104 | protein localization | biological_proccess | IEA |
GO:0007275 | multicellular organismal development | biological_proccess | IEA |
GO:0010552 | positive regulation of specific transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0006983 | ER overload response | biological_proccess | IEA |
GO:0007569 | cell aging | biological_proccess | IEA |
GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0006974 | response to DNA damage stimulus | biological_proccess | IEA |
GO:0006461 | protein complex assembly | biological_proccess | IEA |
GO:0042771 | DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis | biological_proccess | IEA |
GO:0008635 | activation of caspase activity by cytochrome c | biological_proccess | IEA |
GO:0006289 | nucleotide-excision repair | biological_proccess | IEA |
GO:0042149 | cellular response to glucose starvation | biological_proccess | IEA |
GO:0010332 | response to gamma radiation | biological_proccess | IDA |
GO:0006917 | induction of apoptosis | biological_proccess | IDA |
GO:0051453 | regulation of intracellular pH | biological_proccess | IEA |
GO:0003700 | transcription factor activity | mollecular_function | IDA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0003677 | DNA binding | mollecular_function | IDA |
GO:0003682 | chromatin binding | mollecular_function | ISO |
GO:0046982 | protein heterodimerization activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0003700 | transcription factor activity | mollecular_function | IEA |
GO:0008134 | transcription factor binding | mollecular_function | IEA |
GO:0019899 | enzyme binding | mollecular_function | IEA |
GO:0010843 | promoter binding | mollecular_function | IEA |
GO:0047485 | protein N-terminus binding | mollecular_function | IEA |
GO:0051087 | chaperone binding | mollecular_function | IEA |
GO:0003682 | chromatin binding | mollecular_function | IEA |
GO:0005507 | copper ion binding | mollecular_function | IEA |
GO:0000739 | DNA strand annealing activity | mollecular_function | IEA |
GO:0003677 | DNA binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IDA |
GO:0005657 | replication fork | cell_component | IDA |
GO:0005737 | cytoplasm | cell_component | IDA |
GO:0005829 | cytosol | cell_component | IDA |
GO:0005783 | endoplasmic reticulum | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0016605 | PML body | cell_component | IEA |
GO:0005730 | nucleolus | cell_component | IEA |
GO:0016363 | nuclear matrix | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005669 | transcription factor TFIID complex | cell_component | IEA |
GO:0005654 | nucleoplasm | cell_component | IEA |
GO:0005626 | insoluble fraction | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:98834
- Ensembl genome browser [?] : ENSMUSG00000059552
- Expression info from Arrayexpress [?] : ENSMUSG00000059552
- Protein expression from Protein Atlas: [?] ENSMUSG00000059552
- Community gene edition from Wikigenes: [?] 22059
- entrezgene: 22059
- refseq_dna: NM_011640
- refseq_dna: NM_001127233
- refseq_peptide: NP_035770
- refseq_peptide: NP_001120705
Click on [?] for more information.