CYLD (Mus musculus)
Description [+]
- Synonyms: CYLD, CYLD, CYLINDROMATOSIS (TURBAN TUMOR SYNDROME)
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: cylindromatosis (turban tumor syndrome) Gene [Source:MGI Symbol;Acc:MGI:1921506]
- Family: other
- Process: necroptosis,
- Pathways: TNF/NF-kappaB signaling,
- Criteria: manually curated
- Curator comment:
- Human ortholog(s): CYLD
- WIKI: CYLD-M_musculus
References [+]
- Identification of a molecular signaling network that regulates a cellular necrotic cell death pathway.
- Hitomi J, Christofferson DE, Ng A, Yao J, Degterev A, Xavier RJ, Yuan J
- Stimulation of death receptors by agonists such as FasL and TNFalpha activates apoptotic cell death in apoptotic-competent conditions or a type of necrotic cell death dependent on RIP1 kinase, termed necroptosis, in apoptotic-deficient conditions. In a genome-wide siRNA screen for regulators of necroptosis, we identify a set of 432 genes that regulate necroptosis, a subset of 32 genes that act downstream and/or as regulators of RIP1 kinase, 32 genes required for death-receptor-mediated apoptosis, and 7 genes involved in both necroptosis and apoptosis. We show that the expression of subsets of the 432 genes is enriched in the immune and nervous systems, and cellular sensitivity to necroptosis is regulated by an extensive signaling network mediating innate immunity. Interestingly, Bmf, a BH3-only Bcl-2 family member, is required for death-receptor-induced necroptosis. Our study defines a cellular signaling network that regulates necroptosis and the molecular bifurcation that controls apoptosis and necroptosis. Cell. 2008 Dec 26;135(7):1311-23.
- References from Human ortholog(s):
- TNF-alpha induces two distinct caspase-8 activation pathways.
- Wang L, Du F, Wang X
- The inflammatory response of mammalian cells to TNF-alpha can be switched to apoptosis either by cotreatment with a protein synthesis inhibitor, cycloheximide, or Smac mimetic, a small molecule mimic of Smac/Diablo protein. Cycloheximide promotes caspase-8 activation by eliminating endogenous caspase-8 inhibitor, c-FLIP, while Smac mimetic does so by triggering autodegradation of cIAP1 and cIAP2 (cIAP1/2), leading to the release of receptor interacting protein kinase (RIPK1) from the activated TNF receptor complex to form a caspase-8-activating complex consisting of RIPK1, FADD, and caspase-8. This process also requires the action of CYLD, a RIPK1 K63 deubiquitinating enzyme. RIPK1 is critical for caspase-8 activation-induced by Smac mimetic but dispensable for that triggered by cycloheximide. Moreover, Smac mimetic-induced caspase-8 activation is not blocked by endogenous c-FLIP. These findings revealed that TNF-alpha is able to induce apoptosis via two distinct caspase-8 activation pathways that are differentially regulated by cIAP1/2 and c-FLIP. Cell. 2008 May 16;133(4):693-703.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | CAP_GLY | 127 | 203 |
PFAM A | CAP_GLY | 232 | 303 |
PFAM A | CAP_GLY | 471 | 539 |
PFAM A | UCH | 588 | 946 |
Protein sequence [+]
Cyld | Mus musculus | 10090 | length:955
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRV
PSTKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERLSLFRNRLRLS
KGLQVDVGSPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLELIEDDDNGLESDFAGPGDTMQVEPPPLEINSRVSLKV
GESTESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFASVESTILLHIN
DIIPALSDSVTQERRPPKLAFMSRGVGDKGSSSHNKPKVTGSTSDPGSRNRSELFYTLNG
SSVDSQQSKSKNPWYIDEVAEDPAKSLTEMSSDFGHSSPPPQPPSMNSLSSENRFHSLPF
SLTKMPNTNGSMAHSPLSLSVQSVMGELNSTPVQESPPLPISSGNAHGLEVGSLAEVKEN
PPFYGVIRWIGQPPGLSDVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRP
DSRFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSC
YLDSTLFCLFAFSSALDTVLLRPKEKNDIEYYSETQELLRTEIVNPLRIYGYVCATKIMK
LRKILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEK
NEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLL
EDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLP
KDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGF
NIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
PSTKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERLSLFRNRLRLS
KGLQVDVGSPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLELIEDDDNGLESDFAGPGDTMQVEPPPLEINSRVSLKV
GESTESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFASVESTILLHIN
DIIPALSDSVTQERRPPKLAFMSRGVGDKGSSSHNKPKVTGSTSDPGSRNRSELFYTLNG
SSVDSQQSKSKNPWYIDEVAEDPAKSLTEMSSDFGHSSPPPQPPSMNSLSSENRFHSLPF
SLTKMPNTNGSMAHSPLSLSVQSVMGELNSTPVQESPPLPISSGNAHGLEVGSLAEVKEN
PPFYGVIRWIGQPPGLSDVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRP
DSRFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSC
YLDSTLFCLFAFSSALDTVLLRPKEKNDIEYYSETQELLRTEIVNPLRIYGYVCATKIMK
LRKILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEK
NEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLL
EDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLP
KDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGF
NIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
A_aegypti_AAEL013253-PA | orthology | Aedes |
A_gambiae_AGAP008412-PA | orthology | Anopheles |
CYLD | orthology | Chicken |
CYLD | orthology | Chimpanzee |
CYLD_BOVIN | orthology | Cow |
CYLD | orthology | Dog |
CYLD | orthology | Fly |
CYLD | orthology | Fugu |
CYLD | orthology | Gasterosteus |
CYLD | orthology | Gorilla |
CYLD | orthology | Horse |
CYLD | orthology | Human |
CYLD | orthology | Human |
A_carolinensis_ENSACAP00000009015 | orthology | Lyzard |
CYLD | orthology | Macaca |
CYLD | orthology | Medaka |
CYLD | orthology | Monodelphis |
Q5RED8_PONPY | orthology | Orangutan |
CYLD | orthology | Ornithorhynchus |
CYLD | orthology | Rabbit |
LOC691222 | orthology | Rat |
CYLD (2 of 2) | orthology | Tetraodon |
cyld-1 | orthology | Worm |
CYLD | orthology | Zebra finch |
CYLD | orthology | Zebrafish |
G_gallus_ENSGALP00000025944 | paralogy | Chicken |
C_intestinalis_ENSCINP00000026477 | paralogy | Ciona |
T_rubripes_ENSTRUP00000000520 | paralogy | Fugu |
G_aculeatus_ENSGACP00000024956 | paralogy | Gasterosteus |
G_aculeatus_ENSGACP00000007078 | paralogy | Gasterosteus |
G_aculeatus_ENSGACP00000013429 | paralogy | Gasterosteus |
A_carolinensis_ENSACAP00000009497 | paralogy | Lyzard |
A_carolinensis_ENSACAP00000001971 | paralogy | Lyzard |
O_latipes_ENSORLP00000017400 | paralogy | Medaka |
O_latipes_ENSORLP00000011256 | paralogy | Medaka |
R_norvegicus_ENSRNOP00000058543 | paralogy | Rat |
T_nigroviridis_ENSTNIP00000006284 | paralogy | Tetraodon |
CYLD | paralogy | Xenopus |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006412 | translation | biological_proccess | IEA |
GO:0006511 | ubiquitin-dependent protein catabolic process | biological_proccess | IEA |
GO:0019941 | modification-dependent protein catabolic process | biological_proccess | IEA |
GO:0003735 | structural constituent of ribosome | mollecular_function | IEA |
GO:0004221 | ubiquitin thiolesterase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0008233 | peptidase activity | mollecular_function | IEA |
GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
GO:0016787 | hydrolase activity | mollecular_function | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005840 | ribosome | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0048471 | perinuclear region of cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:1921506
- Ensembl genome browser [?] : ENSMUSG00000036712
- Expression info from Arrayexpress [?] : ENSMUSG00000036712
- Protein expression from Protein Atlas: [?] ENSMUSG00000036712
- Community gene edition from Wikigenes: [?] 74256
- entrezgene: 74256
- refseq_dna: NM_001128171
- refseq_dna: NM_173369
- refseq_dna: NM_001128170
- refseq_dna: NM_001128169
- refseq_peptide: NP_001121643
- refseq_peptide: NP_775545
- refseq_peptide: NP_001121642
- refseq_peptide: NP_001121641
Click on [?] for more information.