DIABLO (Mus musculus)
Description [+]
- Synonyms: DIABLO, DIABLO HOMOLOG (DROSOPHILA), 0610041G12RIK, 1700006L01RIK, SMAC
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: Diablo homolog, mitochondrial Precursor (Second mitochondria-derived activator of caspase)(Smac protein)(Direct IAP-binding protein with low pI) [Source:UniProtKB/Swiss-Prot;Acc:Q9JIQ3]
- Family: IAP antagonist
- Process:
- Pathways:
- Criteria: manually curated
- Curator comment:
- WIKI: DIABLO-M_musculus
References [+]
- Generation and characterization of Smac/DIABLO-deficient mice.
- Okada H, Suh WK, Jin J, Woo M, Du C, Elia A, Duncan GS, Wakeham A, Itie A, Lowe SW, Wang X, Mak TW
- The mitochondrial proapoptotic protein Smac/DIABLO has recently been shown to potentiate apoptosis by counteracting the antiapoptotic function of the inhibitor of apoptosis proteins (IAPs). In response to apoptotic stimuli, Smac is released into the cytosol and promotes caspase activation by binding to IAPs, thereby blocking their function. These observations have suggested that Smac is a new regulator of apoptosis. To better understand the physiological function of Smac in normal cells, we generated Smac-deficient (Smac(-/-)) mice by using homologous recombination in embryonic stem (ES) cells. Smac(-/-) mice were viable, grew, and matured normally and did not show any histological abnormalities. Although the cleavage in vitro of procaspase-3 was inhibited in lysates of Smac(-/-) cells, all types of cultured Smac(-/-) cells tested responded normally to all apoptotic stimuli applied. There were also no detectable differences in Fas-mediated apoptosis in the liver in vivo. Our data strongly suggest the existence of a redundant molecule or molecules capable of compensating for a loss of Smac function. Mol Cell Biol. 2002 May;22(10):3509-17.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Smac_DIABLO | 6 | 237 |
Protein sequence [+]
Diablo | Mus musculus | 10090 | length:237
MAALRSWVTRSVCSLFRYRQRFPVLANSKKRCFSELIKPWHKTVLTGFGMTLCAVPIAQK
SEPQSLSNEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLVSLYRQYTSLLG
KMNSQEEDEVWQVIIGARVEMTSKQQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASIT
ARNHIQLVKSQVQEVRQLSQKAETKLAEAQTKELHQKAQEVSDEGADQEEEAYLRED
SEPQSLSNEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLVSLYRQYTSLLG
KMNSQEEDEVWQVIIGARVEMTSKQQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASIT
ARNHIQLVKSQVQEVRQLSQKAETKLAEAQTKELHQKAQEVSDEGADQEEEAYLRED
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IDA |
GO:0008631 | induction of apoptosis by oxidative stress | biological_proccess | IDA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IDA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IDA |
GO:0005739 | mitochondrion | cell_component | IDA |
GO:0005758 | mitochondrial intermembrane space | cell_component | ISO |
GO:0005739 | mitochondrion | cell_component | IEA |
Check GO Evidence Codes here
Curated Isoforms [+]
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from MGI [?] MGI:1913843
- Ensembl genome browser [?] : ENSMUSG00000029433
- Expression info from Arrayexpress [?] : ENSMUSG00000029433
- Protein expression from Protein Atlas: [?] ENSMUSG00000029433
- Community gene edition from Wikigenes: [?] 66593
Click on [?] for more information.