ENSOANG00000001386 (Ornithorhynchus anatinus)
Description [+]
- Synonyms:
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Prototheria; Ornithorhynchus anatinus
- Short gene description:
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: -O_anatinus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | PAAD_DAPIN | 4 | 86 |
PFAM A | CARD | 115 | 198 |
Protein sequence [+]
| Ornithorhynchus anatinus | 9258 | length:198
MGSARDHILTALENLTSDEFKKFKTKLLSCPLREGFGRIPRGPLMNMDVIDLTDKIVTTY
MENYGLELTTAILRDINQAEAAALQKATGADLPCLSLFLTAAPRVGPSKIALEQQHFMDK
HRQALINRVTSVDALLDALYGKVLSEQQYQEVRAEKPSANQMRKLFSFSVAWNRSCKDQL
FQALKATHPFLVSDLENS
MENYGLELTTAILRDINQAEAAALQKATGADLPCLSLFLTAAPRVGPSKIALEQQHFMDK
HRQALINRVTSVDALLDALYGKVLSEQQYQEVRAEKPSANQMRKLFSFSVAWNRSCKDQL
FQALKATHPFLVSDLENS
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0043281 | regulation of caspase activity | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSOANG00000001386
- Expression info from Arrayexpress [?] : ENSOANG00000001386
- Protein expression from Protein Atlas: [?] ENSOANG00000001386
- entrezgene: 100087358
Click on [?] for more information.