CD40LG (Ornithorhynchus anatinus)
Description [+]
- Synonyms: CD40LG
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Prototheria; Ornithorhynchus anatinus
- Short gene description: CD40 ligand (CD40-L)(Tumor necrosis factor ligand superfamily member 5)(TNF-related activation protein)(TRAP)(T-cell antigen Gp39)(CD154 antigen) [Contains CD40 ligand, membrane form;CD40 ligand, soluble form] [Source:UniProtKB/Swiss-Prot;Acc:P29965]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CD40LG-O_anatinus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 140 | 261 |
Protein sequence [+]
CD40LG | Ornithorhynchus anatinus | 9258 | length:261
MNEVYSQPSPRSVNTGSPATMKFLLGFLTVFVTAQIIATALFGIYLHRRLDKVKDEMSLH
EDYVFMKTVQKCHNGGASSTLLNCEEIRHRFQKLLERKLIWLRRKRRKEKHFSNHRNYEQ
KHPIAAHLIGVKNNESASVLQWMKKGRFTMSHLLSYKAGKLTVERPGLYYIYTQVGFCSK
DVATEKEPFVTYLYLSQKSGAVSPLLKGANSQTSTQHCGLQSIHIGGVFDLQQGVSVFVR
VTKSSQVFYDSELTYFGLIKL
EDYVFMKTVQKCHNGGASSTLLNCEEIRHRFQKLLERKLIWLRRKRRKEKHFSNHRNYEQ
KHPIAAHLIGVKNNESASVLQWMKKGRFTMSHLLSYKAGKLTVERPGLYYIYTQVGFCSK
DVATEKEPFVTYLYLSQKSGAVSPLLKGANSQTSTQHCGLQSIHIGGVFDLQQGVSVFVR
VTKSSQVFYDSELTYFGLIKL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0030183 | B cell differentiation | biological_proccess | IEA |
GO:0045190 | isotype switching | biological_proccess | IEA |
GO:0048305 | immunoglobulin secretion | biological_proccess | IEA |
GO:0051023 | regulation of immunoglobulin secretion | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0030168 | platelet activation | biological_proccess | IEA |
GO:0042100 | B cell proliferation | biological_proccess | IEA |
GO:0032735 | positive regulation of interleukin-12 production | biological_proccess | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005174 | CD40 receptor binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSOANG00000011672
- Expression info from Arrayexpress [?] : ENSOANG00000011672
- Protein expression from Protein Atlas: [?] ENSOANG00000011672
- entrezgene: 100083615
Click on [?] for more information.