ENSOCUG00000004495 (Oryctolagus cuniculus)
Description [+]
- Synonyms:
- Species: Oryctolagus cuniculus
- Short gene description:
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: -O_cuniculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | PAAD_DAPIN | 4 | 87 |
PFAM A | CARD | 113 | 196 |
Protein sequence [+]
| Oryctolagus cuniculus | 9986 | length:196
MGRARDAILEALENLTADEFKKFKHKLLSVPLREGYGRIPRGTLLSMDAVDLTDKLVSFY
LETYGAELTAAVLRDMGMQESAEQLEELLSQGSGAAPAAGIKAHSEKIAKPALHFVDQHR
AALISRVTDVDGVLDVLHGRVLTEEQYQAVRAETTNPNKMRKLFSFAPAWDLTCKDLLLQ
ALRDTQPYLVADLEPR
LETYGAELTAAVLRDMGMQESAEQLEELLSQGSGAAPAAGIKAHSEKIAKPALHFVDQHR
AALISRVTDVDGVLDVLHGRVLTEEQYQAVRAETTNPNKMRKLFSFAPAWDLTCKDLLLQ
ALRDTQPYLVADLEPR
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0043281 | regulation of caspase activity | biological_proccess | IEA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0050718 | positive regulation of interleukin-1 beta secretion | biological_proccess | IEA |
GO:0033209 | tumor necrosis factor-mediated signaling pathway | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0042803 | protein homodimerization activity | mollecular_function | IEA |
GO:0032090 | Pyrin domain binding | mollecular_function | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSOCUG00000004495
- Expression info from Arrayexpress [?] : ENSOCUG00000004495
- Protein expression from Protein Atlas: [?] ENSOCUG00000004495
Click on [?] for more information.