BAD (Pongo pygmaeus)
Description [+]
- Synonyms: BAD
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pongo pygmaeus
- Short gene description: Bcl2 antagonist of cell death (BAD)(Bcl-2-binding component 6)(Bcl-XL/Bcl-2-associated death promoter)(Bcl-2-like 8 protein) [Source:UniProtKB/Swiss-Prot;Acc:Q92934]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BAD-P_pygmaeus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Bcl-2_BAD | 1 | 168 |
Protein sequence [+]
BAD | Pongo pygmaeus | 9600 | length:168
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSGSSKHHRQAPGLLRDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0008283 | cell proliferation | biological_proccess | IEA |
GO:0042593 | glucose homeostasis | biological_proccess | IEA |
GO:0019221 | cytokine-mediated signaling pathway | biological_proccess | IEA |
GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IEA |
GO:0045582 | positive regulation of T cell differentiation | biological_proccess | IEA |
GO:0045579 | positive regulation of B cell differentiation | biological_proccess | IEA |
GO:0043281 | regulation of caspase activity | biological_proccess | IEA |
GO:0006007 | glucose catabolic process | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPPYG00000003110
- Expression info from Arrayexpress [?] : ENSPPYG00000003110
- Protein expression from Protein Atlas: [?] ENSPPYG00000003110
Click on [?] for more information.