TP73 (Pan troglodytes)
Description [+]
- Synonyms: TP73
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pan troglodytes
- Short gene description: Tumor protein p73 (p53-like transcription factor)(p53-related protein) [Source:UniProtKB/Swiss-Prot;Acc:O15350]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TP73-P_troglodytes
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | P53 | 111 | 258 |
PFAM A | SAM_2 | 297 | 363 |
Protein sequence [+]
TP73 | Pan troglodytes | 9598 | length:448
MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTS
VMQFHLLSSTMDQMSSRAWASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTDYP
GPHHFEVTFQQSSTAKSATWTYSPLVKTLYCQIAKTCPILIKAIRAMPVYIAEHVTDVHK
RCPNHELGRDFNEASHLFRVKANNLSQYVDDPVGRQSVVVPYEPPQGAAKRAFKQSPPAV
PALGAGVKKRRHGDEDTYYLQPGMLNNHGHAVPANGEMGSSHSAQSMVSGSHCTPPPPYH
ADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDL
KQGHDYSTTQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGPGGGPDE
WADFGFDLPDCKARKQPIKEEFTEAEIH
VMQFHLLSSTMDQMSSRAWASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTDYP
GPHHFEVTFQQSSTAKSATWTYSPLVKTLYCQIAKTCPILIKAIRAMPVYIAEHVTDVHK
RCPNHELGRDFNEASHLFRVKANNLSQYVDDPVGRQSVVVPYEPPQGAAKRAFKQSPPAV
PALGAGVKKRRHGDEDTYYLQPGMLNNHGHAVPANGEMGSSHSAQSMVSGSHCTPPPPYH
ADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDL
KQGHDYSTTQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGPGGGPDE
WADFGFDLPDCKARKQPIKEEFTEAEIH
Structure links:
- Smartdomain prediction information: SM00454
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0045449 | regulation of transcription | biological_proccess | IEA |
GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0045893 | positive regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0006974 | response to DNA damage stimulus | biological_proccess | IEA |
GO:0009791 | post-embryonic development | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0007050 | cell cycle arrest | biological_proccess | IEA |
GO:0030900 | forebrain development | biological_proccess | IEA |
GO:0048666 | neuron development | biological_proccess | IEA |
GO:0043524 | negative regulation of neuron apoptosis | biological_proccess | IEA |
GO:0021766 | hippocampus development | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0043508 | negative regulation of JUN kinase activity | biological_proccess | IEA |
GO:0045793 | positive regulation of cell size | biological_proccess | IEA |
GO:0033326 | cerebrospinal fluid secretion | biological_proccess | IEA |
GO:0048546 | digestive tract morphogenesis | biological_proccess | IEA |
GO:0043523 | regulation of neuron apoptosis | biological_proccess | IEA |
GO:0003700 | transcription factor activity | mollecular_function | IEA |
GO:0003677 | DNA binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0002039 | p53 binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPTRG00000000062
- Expression info from Arrayexpress [?] : ENSPTRG00000000062
- Protein expression from Protein Atlas: [?] ENSPTRG00000000062
Click on [?] for more information.