TRAF6 (Pan troglodytes)
Description [+]
- Synonyms: TRAF6
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pan troglodytes
- Short gene description: TNF receptor-associated factor 6 (Interleukin-1 signal transducer)(RING finger protein 85) [Source:UniProtKB/Swiss-Prot;Acc:Q9Y4K3]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TRAF6-P_troglodytes
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | zf-C3HC4 | 70 | 108 |
PFAM A | zf-TRAF | 151 | 202 |
PFAM A | zf-TRAF | 204 | 261 |
PFAM A | MATH | 357 | 501 |
Protein sequence [+]
TRAF6 | Pan troglodytes | 9598 | length:522
MSLLNCENSCGSSQSESDCCVAMASSCSAATKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0016567 | protein ubiquitination | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0009887 | organ morphogenesis | biological_proccess | IEA |
GO:0019886 | antigen processing and presentation of exogenous peptide antigen via MHC class II | biological_proccess | IEA |
GO:0001503 | ossification | biological_proccess | IEA |
GO:0042475 | odontogenesis of dentine-containing tooth | biological_proccess | IEA |
GO:0001843 | neural tube closure | biological_proccess | IEA |
GO:0045084 | positive regulation of interleukin-12 biosynthetic process | biological_proccess | IEA |
GO:0045410 | positive regulation of interleukin-6 biosynthetic process | biological_proccess | IEA |
GO:0043011 | myeloid dendritic cell differentiation | biological_proccess | IEA |
GO:0042088 | T-helper 1 type immune response | biological_proccess | IEA |
GO:0048468 | cell development | biological_proccess | IEA |
GO:0051023 | regulation of immunoglobulin secretion | biological_proccess | IEA |
GO:0002726 | positive regulation of T cell cytokine production | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0050852 | T cell receptor signaling pathway | biological_proccess | IEA |
GO:0000209 | protein polyubiquitination | biological_proccess | IEA |
GO:0032743 | positive regulation of interleukin-2 production | biological_proccess | IEA |
GO:0007250 | activation of NF-kappaB-inducing kinase activity | biological_proccess | IEA |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004842 | ubiquitin-protein ligase activity | mollecular_function | IEA |
GO:0000151 | ubiquitin ligase complex | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005624 | membrane fraction | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPTRG00000003510
- Expression info from Arrayexpress [?] : ENSPTRG00000003510
- Protein expression from Protein Atlas: [?] ENSPTRG00000003510
- entrezgene: 451702
Click on [?] for more information.