CRADD (Pan troglodytes)
Description [+]
- Synonyms: CRADD
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pan troglodytes
- Short gene description: Death domain-containing protein CRADD (Caspase and RIP adapter with death domain)(RIP-associated protein with a death domain) [Source:UniProtKB/Swiss-Prot;Acc:P78560]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CRADD-P_troglodytes
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | CARD | 6 | 89 |
PFAM A | Death | 117 | 198 |
Protein sequence [+]
CRADD | Pan troglodytes | 9598 | length:199
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDI
LPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQI
NQLAQRLGPEWEPVVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSL
HNGLRAVEVDPSLLLHMLE
LPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQI
NQLAQRLGPEWEPVVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSL
HNGLRAVEVDPSLLLHMLE
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0070513 | death domain binding | mollecular_function | IEA |
GO:0002020 | protease binding | mollecular_function | IEA |
GO:0030674 | protein binding, bridging | mollecular_function | IEA |
GO:0005622 | intracellular | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPTRG00000005300
- Expression info from Arrayexpress [?] : ENSPTRG00000005300
- Protein expression from Protein Atlas: [?] ENSPTRG00000005300
- entrezgene: 452128
Click on [?] for more information.