SCARB1 (Pan troglodytes)
Description [+]
- Synonyms: SCARB1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pan troglodytes
- Short gene description: Scavenger receptor class B member 1 (SRB1)(SR-BI)(CD36 antigen-like 1)(CD36 and LIMPII analogous 1)(CLA-1)(Collagen type I receptor, thrombospondin receptor-like 1)(CD36 antigen) [Source:UniProtKB/Swiss-Prot;Acc:Q8WTV0]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: SCARB1-P_troglodytes
Structure & Sequence [+]
Protein sequence [+]
SCARB1 | Pan troglodytes | 9598 | length:509
MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIP
IPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQ
FQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIM
WGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGL
SKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFEGIPTYR
FVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAVTG
LHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG
AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQEKCYLFWSSSKKG
SKDKEAIQAYSESLMTSAPKGSVLQEAKL
IPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQ
FQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIM
WGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGL
SKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFEGIPTYR
FVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAVTG
LHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG
AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQEKCYLFWSSSKKG
SKDKEAIQAYSESLMTSAPKGSVLQEAKL
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007155 | cell adhesion | biological_proccess | IEA |
GO:0015833 | peptide transport | biological_proccess | IEA |
GO:0042632 | cholesterol homeostasis | biological_proccess | IEA |
GO:0043534 | blood vessel endothelial cell migration | biological_proccess | IEA |
GO:0033344 | cholesterol efflux | biological_proccess | IEA |
GO:0006707 | cholesterol catabolic process | biological_proccess | IEA |
GO:0034375 | high-density lipoprotein particle remodeling | biological_proccess | IEA |
GO:0043691 | reverse cholesterol transport | biological_proccess | IEA |
GO:0030301 | cholesterol transport | biological_proccess | IEA |
GO:0001935 | endothelial cell proliferation | biological_proccess | IEA |
GO:0070328 | triglyceride homeostasis | biological_proccess | IEA |
GO:0070508 | cholesterol import | biological_proccess | IEA |
GO:0051000 | positive regulation of nitric-oxide synthase activity | biological_proccess | IEA |
GO:0034384 | high-density lipoprotein particle clearance | biological_proccess | IEA |
GO:0043654 | recognition of apoptotic cell | biological_proccess | IEA |
GO:0010886 | positive regulation of cholesterol storage | biological_proccess | IEA |
GO:0032497 | detection of lipopolysaccharide | biological_proccess | IEA |
GO:0051856 | adhesion to symbiont | biological_proccess | IEA |
GO:0015920 | lipopolysaccharide transport | biological_proccess | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0015197 | peptide transporter activity | mollecular_function | IEA |
GO:0008035 | high-density lipoprotein binding | mollecular_function | IEA |
GO:0034185 | apolipoprotein binding | mollecular_function | IEA |
GO:0070506 | high-density lipoprotein receptor activity | mollecular_function | IEA |
GO:0034186 | apolipoprotein A-I binding | mollecular_function | IEA |
GO:0001875 | lipopolysaccharide receptor activity | mollecular_function | IEA |
GO:0030169 | low-density lipoprotein binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005887 | integral to plasma membrane | cell_component | IEA |
GO:0000299 | integral to membrane of membrane fraction | cell_component | IEA |
GO:0005901 | caveola | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPTRG00000005616
- Expression info from Arrayexpress [?] : ENSPTRG00000005616
- Protein expression from Protein Atlas: [?] ENSPTRG00000005616
Click on [?] for more information.