TP53 (Pan troglodytes)
Description [+]
- Synonyms: TP53
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pan troglodytes
- Short gene description: Cellular tumor antigen p53 (Tumor suppressor p53)(Phosphoprotein p53)(Antigen NY-CO-13) [Source:UniProtKB/Swiss-Prot;Acc:P04637]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TP53-P_troglodytes
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | P53_TAD | 5 | 29 |
PFAM A | P53 | 95 | 289 |
PFAM A | P53_tetramer | 318 | 359 |
Protein sequence [+]
TP53 | Pan troglodytes | 9598 | length:393
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP
DEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK
SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS
SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP
PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG
GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
DEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK
SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS
SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP
PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG
GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
Structure links:
- Prosite motif and domain information: PS00348
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0045449 | regulation of transcription | biological_proccess | IEA |
GO:0002347 | response to tumor cell | biological_proccess | IEA |
GO:0030308 | negative regulation of cell growth | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0001701 | in utero embryonic development | biological_proccess | IEA |
GO:0045893 | positive regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0045941 | positive regulation of transcription | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0009303 | rRNA transcription | biological_proccess | IEA |
GO:0006974 | response to DNA damage stimulus | biological_proccess | IEA |
GO:0008285 | negative regulation of cell proliferation | biological_proccess | IEA |
GO:0042127 | regulation of cell proliferation | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0051726 | regulation of cell cycle | biological_proccess | IEA |
GO:0006302 | double-strand break repair | biological_proccess | IEA |
GO:0051276 | chromosome organization | biological_proccess | IEA |
GO:0008156 | negative regulation of DNA replication | biological_proccess | IEA |
GO:0042493 | response to drug | biological_proccess | IEA |
GO:0048147 | negative regulation of fibroblast proliferation | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0007569 | cell aging | biological_proccess | IEA |
GO:0042771 | DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis | biological_proccess | IEA |
GO:0000060 | protein import into nucleus, translocation | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0043525 | positive regulation of neuron apoptosis | biological_proccess | IEA |
GO:0007417 | central nervous system development | biological_proccess | IEA |
GO:0010165 | response to X-ray | biological_proccess | IEA |
GO:0010332 | response to gamma radiation | biological_proccess | IEA |
GO:0033077 | T cell differentiation in the thymus | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0030330 | DNA damage response, signal transduction by p53 class mediator | biological_proccess | IEA |
GO:0009411 | response to UV | biological_proccess | IEA |
GO:0007406 | negative regulation of neuroblast proliferation | biological_proccess | IEA |
GO:0007369 | gastrulation | biological_proccess | IEA |
GO:0043523 | regulation of neuron apoptosis | biological_proccess | IEA |
GO:0009792 | embryonic development ending in birth or egg hatching | biological_proccess | IEA |
GO:0002360 | T cell lineage commitment | biological_proccess | IEA |
GO:0002326 | B cell lineage commitment | biological_proccess | IEA |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IEA |
GO:0009651 | response to salt stress | biological_proccess | IEA |
GO:0031571 | G1 DNA damage checkpoint | biological_proccess | IEA |
GO:0002309 | T cell proliferation during immune response | biological_proccess | IEA |
GO:0034644 | cellular response to UV | biological_proccess | IEA |
GO:0008104 | protein localization | biological_proccess | IEA |
GO:0007275 | multicellular organismal development | biological_proccess | IEA |
GO:0010552 | positive regulation of specific transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0006983 | ER overload response | biological_proccess | IEA |
GO:0006461 | protein complex assembly | biological_proccess | IEA |
GO:0008635 | activation of caspase activity by cytochrome c | biological_proccess | IEA |
GO:0006289 | nucleotide-excision repair | biological_proccess | IEA |
GO:0042149 | cellular response to glucose starvation | biological_proccess | IEA |
GO:0003677 | DNA binding | mollecular_function | IEA |
GO:0003700 | transcription factor activity | mollecular_function | IEA |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0046982 | protein heterodimerization activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0008134 | transcription factor binding | mollecular_function | IEA |
GO:0019899 | enzyme binding | mollecular_function | IEA |
GO:0010843 | promoter binding | mollecular_function | IEA |
GO:0047485 | protein N-terminus binding | mollecular_function | IEA |
GO:0051087 | chaperone binding | mollecular_function | IEA |
GO:0003682 | chromatin binding | mollecular_function | IEA |
GO:0005507 | copper ion binding | mollecular_function | IEA |
GO:0000739 | DNA strand annealing activity | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005657 | replication fork | cell_component | IEA |
GO:0016605 | PML body | cell_component | IEA |
GO:0005730 | nucleolus | cell_component | IEA |
GO:0016363 | nuclear matrix | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005669 | transcription factor TFIID complex | cell_component | IEA |
GO:0005654 | nucleoplasm | cell_component | IEA |
GO:0005626 | insoluble fraction | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPTRG00000008703
- Expression info from Arrayexpress [?] : ENSPTRG00000008703
- Protein expression from Protein Atlas: [?] ENSPTRG00000008703
- entrezgene: 455214
Click on [?] for more information.