PRDX2 (Pan troglodytes)
Description [+]
- Synonyms: PRDX2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pan troglodytes
- Short gene description: Peroxiredoxin-2 (EC 1.11.1.15)(Thioredoxin peroxidase 1)(Thioredoxin-dependent peroxide reductase 1)(Thiol-specific antioxidant protein)(TSA)(PRP)(Natural killer cell-enhancing factor B)(NKEF-B) [Source:UniProtKB/Swiss-Prot;Acc:P32119]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: PRDX2-P_troglodytes
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Redoxin | 7 | 162 |
PFAM A | AhpC-TSA | 8 | 141 |
PFAM A | 1-cysPrx_C | 151 | 194 |
Protein sequence [+]
PRDX2 | Pan troglodytes | 9598 | length:198
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSN
RAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKT
DEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGS
DTIKPNVDDSKEYFSKHN
RAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKT
DEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGS
DTIKPNVDDSKEYFSKHN
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0032088 | negative regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0000187 | activation of MAPK activity | biological_proccess | IEA |
GO:0048538 | thymus development | biological_proccess | IEA |
GO:0048872 | homeostasis of number of cells | biological_proccess | IEA |
GO:0042743 | hydrogen peroxide metabolic process | biological_proccess | IEA |
GO:0042098 | T cell proliferation | biological_proccess | IEA |
GO:0045581 | negative regulation of T cell differentiation | biological_proccess | IEA |
GO:0042744 | hydrogen peroxide catabolic process | biological_proccess | IEA |
GO:0002536 | respiratory burst during acute inflammatory response | biological_proccess | IEA |
GO:0010310 | regulation of hydrogen peroxide metabolic process | biological_proccess | IEA |
GO:0010671 | negative regulation of oxygen and reactive oxygen species metabolic process | biological_proccess | IEA |
GO:0031665 | negative regulation of lipopolysaccharide-mediated signaling pathway | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0016209 | antioxidant activity | mollecular_function | IEA |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
GO:0008379 | thioredoxin peroxidase activity | mollecular_function | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPTRG00000010541
- Expression info from Arrayexpress [?] : ENSPTRG00000010541
- Protein expression from Protein Atlas: [?] ENSPTRG00000010541
Click on [?] for more information.