BIRC8_PANTR (Pan troglodytes)
Description [+]
- Synonyms: BIRC8_PANTR
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pan troglodytes
- Short gene description: Baculoviral IAP repeat-containing protein 8 (Inhibitor of apoptosis- like protein 2) (IAP-like protein 2) (ILP-2). [Source:UniProtKB/Swiss-Prot;Acc:Q95M72]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BIRC8_PANTR-P_troglodytes
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BIR | 7 | 70 |
Protein sequence [+]
BIRC8_PANTR | Pan troglodytes | 9598 | length:236
MTGYEARLITFGTWMYFVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHA
KWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRINDTIFPNPMLQEAIR
MGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENESNQTSLQREISPEEPL
RRLQDEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS
KWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRINDTIFPNPMLQEAIR
MGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENESNQTSLQREISPEEPL
RRLQDEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0043154 | negative regulation of caspase activity | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPTRG00000011425
- Expression info from Arrayexpress [?] : ENSPTRG00000011425
- Protein expression from Protein Atlas: [?] ENSPTRG00000011425
- entrezgene: 450113
- refseq_dna: NM_001009036
- refseq_peptide: NP_001009036
Click on [?] for more information.