MAPK14 (Rattus norvegicus)
Description [+]
- Synonyms: MAPK14
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Mitogen-activated protein kinase 14 (EC 2.7.11.24) (Mitogen-activated protein kinase p38 alpha) (MAP kinase p38 alpha) (CRK1). [Source:UniProtKB/Swiss-Prot;Acc:P70618]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: MAPK14-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase | 24 | 308 |
PFAM A | Pkinase_Tyr | 24 | 250 |
Protein sequence [+]
Mapk14 | Rattus norvegicus | 10116 | length:360
MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006950 | response to stress | biological_proccess | ISS |
GO:0007243 | protein kinase cascade | biological_proccess | ISS |
GO:0046777 | protein amino acid autophosphorylation | biological_proccess | IDA |
GO:0051403 | stress-activated MAPK cascade | biological_proccess | IDA |
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0006950 | response to stress | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0001525 | angiogenesis | biological_proccess | IEA |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
GO:0000902 | cell morphogenesis | biological_proccess | IEA |
GO:0007243 | protein kinase cascade | biological_proccess | IEA |
GO:0019395 | fatty acid oxidation | biological_proccess | IEA |
GO:0045648 | positive regulation of erythrocyte differentiation | biological_proccess | IEA |
GO:0006006 | glucose metabolic process | biological_proccess | IEA |
GO:0007519 | skeletal muscle development | biological_proccess | IEA |
GO:0000077 | DNA damage checkpoint | biological_proccess | IEA |
GO:0031663 | lipopolysaccharide-mediated signaling pathway | biological_proccess | IEA |
GO:0032495 | response to muramyl dipeptide | biological_proccess | IEA |
GO:0002062 | chondrocyte differentiation | biological_proccess | IEA |
GO:0007243 | protein kinase cascade | biological_proccess | TAS |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0004707 | MAP kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0008022 | protein C-terminus binding | mollecular_function | IDA |
GO:0008339 | MP kinase activity | mollecular_function | ISS |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0016301 | kinase activity | mollecular_function | IEA |
GO:0005625 | soluble fraction | cell_component | IDA |
GO:0005634 | nucleus | cell_component | ISS |
GO:0005737 | cytoplasm | cell_component | ISS |
GO:0044445 | cytosolic part | cell_component | IDA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0000922 | spindle pole | cell_component | IEA |
GO:0005623 | cell | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IDA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000000513
- Expression info from Arrayexpress [?] : ENSRNOG00000000513
- Protein expression from Protein Atlas: [?] ENSRNOG00000000513
Click on [?] for more information.