LTB (Rattus norvegicus)
Description [+]
- Synonyms: LTB
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: lymphotoxin B [Source:RefSeq_peptide;Acc:NP_997672]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: LTB-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 168 | 305 |
Protein sequence [+]
Ltb | Rattus norvegicus | 10116 | length:306
MGTRGLQGLGGRPQGRGCLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGRQVEKIVI
GSGAQAQKGLDNKPSCISPSPSSLSETPDPRLHPQRSYSSRNLDPTSQRPVAQPSREASA
WVTTLSPAVDSILDPGVQQLPLGEPETDFSPELPAAHLIGAWMSGQGLSWEASQEEAFLR
SGAQFSRTHGLALPQDGVYYLYCHVGYRGRTPPAGRSRARLFTLRSALYRAGGAYGRGSP
ELLLEGAETVTPVVDPIGYGSLWYTSVGFGGLAQLRSGERIYVNISHPDMVDYRRGKTFF
GAVMVG
GSGAQAQKGLDNKPSCISPSPSSLSETPDPRLHPQRSYSSRNLDPTSQRPVAQPSREASA
WVTTLSPAVDSILDPGVQQLPLGEPETDFSPELPAAHLIGAWMSGQGLSWEASQEEAFLR
SGAQFSRTHGLALPQDGVYYLYCHVGYRGRTPPAGRSRARLFTLRSALYRAGGAYGRGSP
ELLLEGAETVTPVVDPIGYGSLWYTSVGFGGLAQLRSGERIYVNISHPDMVDYRRGKTFF
GAVMVG
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0010467 | gene expression | biological_proccess | IEA |
GO:0043588 | skin development | biological_proccess | IEA |
GO:0045084 | positive regulation of interleukin-12 biosynthetic process | biological_proccess | IEA |
GO:0048535 | lymph node development | biological_proccess | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0043120 | tumor necrosis factor binding | mollecular_function | TAS |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | TAS |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000000836
- Expression info from Arrayexpress [?] : ENSRNOG00000000836
- Protein expression from Protein Atlas: [?] ENSRNOG00000000836
Click on [?] for more information.