CD40LG (Rattus norvegicus)
Description [+]
- Synonyms: CD40LG
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: CD40 ligand (CD40-L) (Tumor necrosis factor ligand superfamily member 5) (CD154 antigen) [Contains: CD40 ligand, membrane form; CD40 ligand, soluble form]. [Source:UniProtKB/Swiss-Prot;Acc:Q9Z2V2]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CD40LG-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | TNF | 137 | 260 |
Protein sequence [+]
Cd40lg | Rattus norvegicus | 10116 | length:260
MIETYSQPSPRSVATGLPASMKIFMYLLTVFLITQMIGSVLFAVYLHRRLDKVEEEASLH
EDFVFVKKLKRCNKGEGSLSLLNCEEMRRQFEDLVKDISLNKEEKKEKSFEMQRGDEDPQ
IAAHVVSEANSNAASVLQWAKKGYYTMKSNLVVLENGRQLTVKREGLYYVYTQVTFCSNR
EPLSQRPFIVSLWLKPSSGSERILLRAANTHSSSKLCEQQSIHLGGVFELQAGASVFVNV
TEASQVIHGIGFSSFGLLKL
EDFVFVKKLKRCNKGEGSLSLLNCEEMRRQFEDLVKDISLNKEEKKEKSFEMQRGDEDPQ
IAAHVVSEANSNAASVLQWAKKGYYTMKSNLVVLENGRQLTVKREGLYYVYTQVTFCSNR
EPLSQRPFIVSLWLKPSSGSERILLRAANTHSSSKLCEQQSIHLGGVFELQAGASVFVNV
TEASQVIHGIGFSSFGLLKL
Structure links:
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006954 | inflammatory response | biological_proccess | ISS |
| GO:0006955 | immune response | biological_proccess | IEA |
| GO:0030168 | platelet activation | biological_proccess | ISS |
| GO:0030183 | B cell differentiation | biological_proccess | IEA |
| GO:0042100 | B cell proliferation | biological_proccess | ISS |
| GO:0045190 | isotype switching | biological_proccess | IEA |
| GO:0051023 | regulation of immunoglobulin secretion | biological_proccess | IEA |
| GO:0048305 | immunoglobulin secretion | biological_proccess | IEA |
| GO:0006916 | anti-apoptosis | biological_proccess | IEA |
| GO:0006954 | inflammatory response | biological_proccess | IEA |
| GO:0030168 | platelet activation | biological_proccess | IEA |
| GO:0042100 | B cell proliferation | biological_proccess | IEA |
| GO:0032735 | positive regulation of interleukin-12 production | biological_proccess | IEA |
| GO:0005125 | cytokine activity | mollecular_function | IEA |
| GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
| GO:0005174 | CD40 receptor binding | mollecular_function | ISS |
| GO:0005174 | CD40 receptor binding | mollecular_function | IEA |
| GO:0005576 | extracellular region | cell_component | IEA |
| GO:0005615 | extracellular space | cell_component | IEA |
| GO:0005886 | plasma membrane | cell_component | IEA |
| GO:0016021 | integral to membrane | cell_component | IEA |
| GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000000871
- Expression info from Arrayexpress [?] : ENSRNOG00000000871
- Protein expression from Protein Atlas: [?] ENSRNOG00000000871
Click on [?] for more information.
