SCRB1_RAT (Rattus norvegicus)
Description [+]
- Synonyms: SCRB1_RAT
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Scavenger receptor class B member 1 (SRB1)(SR-BI) [Source:UniProtKB/Swiss-Prot;Acc:P97943]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: SCRB1_RAT-R_norvegicus
Structure & Sequence [+]
Protein sequence [+]
SCRB1_RAT | Rattus norvegicus | 10116 | length:509
MGVSSRARWVALGLGVLGLLCAALGVIMILMVPSLIKQQVLKNVRIDPSSLSFGMWKEIP
VPFYLSVYFFEVVNPSEVLNGQKPVVRERGPYVYREFRQKVNITFNDNDTVSYIENRSLR
FQPDRSQGSESDYIVLPNILVLGGAVMMEDKPTSLKLLMTLGLVTMGQRAFMNRTVGEIL
WGYEDPFVNFLSKYFPDMFPIKGKFGLFVGMNDSSSGVFTVFTGVQNFSKIHLVDKWNGL
SEVNYWHSEQCNMINGTAGQMWAPFMTPESSLEFFSPEACRSMKLTYQESRVFEGIPTYR
FTAPDTLFANGSVYPPNEGFCPCRESGIQNVSTCRFGAPLFLSQPHFYNADPVLSEAVLG
LNPDPKEHSLFLDIHPVTGIPMNCSVKMQLSLYIKSVKGVGQTGKIEPVVLPLLWFEQSG
MMGGKTLNTFYTQLVLMPQVLHYAQYVLLGLGGLLLLVPIIYQLRSQEKCFLFWSGSKKG
SQDKEAMQAYSESLMSPAAKGTVLQEAKL
VPFYLSVYFFEVVNPSEVLNGQKPVVRERGPYVYREFRQKVNITFNDNDTVSYIENRSLR
FQPDRSQGSESDYIVLPNILVLGGAVMMEDKPTSLKLLMTLGLVTMGQRAFMNRTVGEIL
WGYEDPFVNFLSKYFPDMFPIKGKFGLFVGMNDSSSGVFTVFTGVQNFSKIHLVDKWNGL
SEVNYWHSEQCNMINGTAGQMWAPFMTPESSLEFFSPEACRSMKLTYQESRVFEGIPTYR
FTAPDTLFANGSVYPPNEGFCPCRESGIQNVSTCRFGAPLFLSQPHFYNADPVLSEAVLG
LNPDPKEHSLFLDIHPVTGIPMNCSVKMQLSLYIKSVKGVGQTGKIEPVVLPLLWFEQSG
MMGGKTLNTFYTQLVLMPQVLHYAQYVLLGLGGLLLLVPIIYQLRSQEKCFLFWSGSKKG
SQDKEAMQAYSESLMSPAAKGTVLQEAKL
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001935 | endothelial cell proliferation | biological_proccess | IEA |
GO:0006702 | androgen biosynthetic process | biological_proccess | IDA |
GO:0006707 | cholesterol catabolic process | biological_proccess | IEA |
GO:0006869 | lipid transport | biological_proccess | IMP |
GO:0007155 | cell adhesion | biological_proccess | IEA |
GO:0010886 | positive regulation of cholesterol storage | biological_proccess | ISS |
GO:0034384 | high-density lipoprotein particle clearance | biological_proccess | ISS |
GO:0043534 | blood vessel endothelial cell migration | biological_proccess | IEA |
GO:0043654 | recognition of apoptotic cell | biological_proccess | IDA |
GO:0043691 | reverse cholesterol transport | biological_proccess | ISS |
GO:0050764 | regulation of phagocytosis | biological_proccess | IDA |
GO:0043691 | reverse cholesterol transport | biological_proccess | IEA |
GO:0051000 | positive regulation of nitric-oxide synthase activity | biological_proccess | IEA |
GO:0034384 | high-density lipoprotein particle clearance | biological_proccess | IEA |
GO:0043654 | recognition of apoptotic cell | biological_proccess | IEA |
GO:0010886 | positive regulation of cholesterol storage | biological_proccess | IEA |
GO:0032497 | detection of lipopolysaccharide | biological_proccess | IEA |
GO:0051856 | adhesion to symbiont | biological_proccess | IEA |
GO:0015920 | lipopolysaccharide transport | biological_proccess | IEA |
GO:0042632 | cholesterol homeostasis | biological_proccess | IEA |
GO:0033344 | cholesterol efflux | biological_proccess | IEA |
GO:0034375 | high-density lipoprotein particle remodeling | biological_proccess | IEA |
GO:0030301 | cholesterol transport | biological_proccess | IEA |
GO:0070328 | triglyceride homeostasis | biological_proccess | IEA |
GO:0070508 | cholesterol import | biological_proccess | IEA |
GO:0006910 | phagocytosis, recognition | biological_proccess | IMP |
GO:0050764 | regulation of phagocytosis | biological_proccess | TAS |
GO:0001786 | phosphatidylserine binding | mollecular_function | TAS |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005319 | lipid transporter activity | mollecular_function | TAS |
GO:0030169 | low-density lipoprotein binding | mollecular_function | ISS |
GO:0070506 | high-density lipoprotein receptor activity | mollecular_function | ISS |
GO:0070506 | high-density lipoprotein receptor activity | mollecular_function | IEA |
GO:0034186 | apolipoprotein A-I binding | mollecular_function | IEA |
GO:0001875 | lipopolysaccharide receptor activity | mollecular_function | IEA |
GO:0030169 | low-density lipoprotein binding | mollecular_function | IEA |
GO:0008035 | high-density lipoprotein binding | mollecular_function | IEA |
GO:0034185 | apolipoprotein binding | mollecular_function | IEA |
GO:0000299 | integral to membrane of membrane fraction | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IDA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0005887 | integral to plasma membrane | cell_component | IEA |
GO:0005901 | caveola | cell_component | IEA |
GO:0009986 | cell surface | cell_component | IDA |
GO:0031528 | microvillus membrane | cell_component | IMP |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000000981
- Expression info from Arrayexpress [?] : ENSRNOG00000000981
- Protein expression from Protein Atlas: [?] ENSRNOG00000000981
Click on [?] for more information.