BCL2 (Rattus norvegicus)
Description [+]
- Synonyms: BCL2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Apoptosis regulator Bcl-2. [Source:UniProtKB/Swiss-Prot;Acc:P49950]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BCL2-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BH4 | 7 | 33 |
PFAM A | Bcl-2 | 94 | 192 |
Protein sequence [+]
Bcl2 | Rattus norvegicus | 10116 | length:236
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPA
VHRDTAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR
HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
VHRDTAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR
HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Structure links:
- Smartdomain prediction information: SM00265
- Smartdomain prediction information: SM00337
- Prosite motif and domain information: PS01080
- Prosite motif and domain information: PS01258
- Prosite motif and domain information: PS01259
- Prosite motif and domain information: PS01260
- Interpro domain information: P49950
- PFAM domain and domain family information: P49950
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0000082 | G1/S transition of mitotic cell cycle | biological_proccess | IEA |
GO:0000902 | cell morphogenesis | biological_proccess | IEA |
GO:0001541 | ovarian follicle development | biological_proccess | IEA |
GO:0001657 | ureteric bud development | biological_proccess | IEA |
GO:0001658 | ureteric bud branching | biological_proccess | IEA |
GO:0001662 | behavioral fear response | biological_proccess | IEA |
GO:0001666 | response to hypoxia | biological_proccess | IEP |
GO:0001782 | B cell homeostasis | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | ISS |
GO:0001952 | regulation of cell-matrix adhesion | biological_proccess | IEA |
GO:0002320 | lymphoid progenitor cell differentiation | biological_proccess | IEA |
GO:0002326 | B cell lineage commitment | biological_proccess | IEA |
GO:0002360 | T cell lineage commitment | biological_proccess | IEA |
GO:0002520 | immune system development | biological_proccess | IEA |
GO:0003014 | renal system process | biological_proccess | IEA |
GO:0006470 | protein amino acid dephosphorylation | biological_proccess | IEA |
GO:0006582 | melanin metabolic process | biological_proccess | IEA |
GO:0006800 | oxygen and reactive oxygen species metabolic process | biological_proccess | IEA |
GO:0006808 | regulation of nitrogen utilization | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0006979 | response to oxidative stress | biological_proccess | IEA |
GO:0007015 | actin filament organization | biological_proccess | IEA |
GO:0007569 | cell aging | biological_proccess | IEA |
GO:0007584 | response to nutrient | biological_proccess | IEP |
GO:0008219 | cell death | biological_proccess | IEA |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IEA |
GO:0008584 | male gonad development | biological_proccess | IEA |
GO:0009408 | response to heat | biological_proccess | IEP |
GO:0009605 | response to external stimulus | biological_proccess | IEA |
GO:0009636 | response to toxin | biological_proccess | IEA |
GO:0009791 | post-embryonic development | biological_proccess | IEA |
GO:0009887 | organ morphogenesis | biological_proccess | IEA |
GO:0010035 | response to inorganic substance | biological_proccess | IEP |
GO:0010044 | response to aluminum ion | biological_proccess | IEP |
GO:0010224 | response to UV-B | biological_proccess | IEA |
GO:0010332 | response to gamma radiation | biological_proccess | IEA |
GO:0010468 | regulation of gene expression | biological_proccess | IEA |
GO:0010523 | negative regulation of calcium ion transport into cytosol | biological_proccess | IEA |
GO:0010559 | regulation of glycoprotein biosynthetic process | biological_proccess | IEA |
GO:0014031 | mesenchymal cell development | biological_proccess | IEA |
GO:0014042 | positive regulation of neuron maturation | biological_proccess | IEA |
GO:0014911 | positive regulation of smooth muscle cell migration | biological_proccess | IEA |
GO:0016337 | cell-cell adhesion | biological_proccess | IEA |
GO:0018107 | peptidyl-threonine phosphorylation | biological_proccess | IEA |
GO:0021747 | cochlear nucleus development | biological_proccess | IEA |
GO:0022612 | gland morphogenesis | biological_proccess | IEA |
GO:0030097 | hemopoiesis | biological_proccess | IEA |
GO:0030279 | negative regulation of ossification | biological_proccess | IEA |
GO:0030308 | negative regulation of cell growth | biological_proccess | IEA |
GO:0030336 | negative regulation of cell migration | biological_proccess | IEA |
GO:0031000 | response to caffeine | biological_proccess | IEP |
GO:0031069 | hair follicle morphogenesis | biological_proccess | IEA |
GO:0031103 | axon regeneration | biological_proccess | IEA |
GO:0031647 | regulation of protein stability | biological_proccess | IEA |
GO:0032469 | endoplasmic reticulum calcium ion homeostasis | biological_proccess | IEA |
GO:0032835 | glomerulus development | biological_proccess | IEA |
GO:0032880 | regulation of protein localization | biological_proccess | IEA |
GO:0033033 | negative regulation of myeloid cell apoptosis | biological_proccess | IEA |
GO:0033077 | T cell differentiation in the thymus | biological_proccess | IEA |
GO:0033138 | positive regulation of peptidyl-serine phosphorylation | biological_proccess | IEA |
GO:0033689 | negative regulation of osteoblast proliferation | biological_proccess | IEA |
GO:0034097 | response to cytokine stimulus | biological_proccess | IEA |
GO:0035094 | response to nicotine | biological_proccess | IEP |
GO:0035265 | organ growth | biological_proccess | IEA |
GO:0040018 | positive regulation of multicellular organism growth | biological_proccess | IEA |
GO:0042493 | response to drug | biological_proccess | IEA |
GO:0042542 | response to hydrogen peroxide | biological_proccess | IEA |
GO:0043029 | T cell homeostasis | biological_proccess | IEA |
GO:0043085 | positive regulation of catalytic activity | biological_proccess | IEA |
GO:0043375 | CD8-positive, alpha-beta T cell lineage commitment | biological_proccess | IEA |
GO:0043434 | response to peptide hormone stimulus | biological_proccess | IEP |
GO:0043524 | negative regulation of neuron apoptosis | biological_proccess | IEA |
GO:0043583 | ear development | biological_proccess | IEA |
GO:0043627 | response to estrogen stimulus | biological_proccess | IEP |
GO:0045069 | regulation of viral genome replication | biological_proccess | IEA |
GO:0045471 | response to ethanol | biological_proccess | IEP |
GO:0045636 | positive regulation of melanocyte differentiation | biological_proccess | IEA |
GO:0045930 | negative regulation of mitotic cell cycle | biological_proccess | IEA |
GO:0046671 | negative regulation of retinal cell programmed cell death | biological_proccess | IEA |
GO:0046688 | response to copper ion | biological_proccess | IEP |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | ISS |
GO:0048041 | focal adhesion formation | biological_proccess | IEA |
GO:0048087 | positive regulation of pigmentation during development | biological_proccess | IEA |
GO:0048536 | spleen development | biological_proccess | IEA |
GO:0048538 | thymus development | biological_proccess | IEA |
GO:0048547 | gut morphogenesis | biological_proccess | IEA |
GO:0048589 | developmental growth | biological_proccess | IEA |
GO:0048599 | oocyte development | biological_proccess | IEA |
GO:0048743 | positive regulation of skeletal muscle fiber development | biological_proccess | IEA |
GO:0048753 | pigment granule organization | biological_proccess | IEA |
GO:0048873 | homeostasis of number of cells within a tissue | biological_proccess | IEA |
GO:0051412 | response to corticosterone stimulus | biological_proccess | IEP |
GO:0051593 | response to folic acid | biological_proccess | IEP |
GO:0051726 | regulation of cell cycle | biological_proccess | IEA |
GO:0051789 | response to protein stimulus | biological_proccess | IEA |
GO:0051881 | regulation of mitochondrial membrane potential | biological_proccess | ISS |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0010039 | response to iron ion | biological_proccess | IEA |
GO:0043497 | regulation of protein heterodimerization activity | biological_proccess | IEA |
GO:0070059 | apoptosis in response to endoplasmic reticulum stress | biological_proccess | IEA |
GO:0035094 | response to nicotine | biological_proccess | IEA |
GO:0051607 | defense response to virus | biological_proccess | IEA |
GO:0043496 | regulation of protein homodimerization activity | biological_proccess | IEA |
GO:0051924 | regulation of calcium ion transport | biological_proccess | IEA |
GO:0042100 | B cell proliferation | biological_proccess | IEA |
GO:0032848 | negative regulation of cellular pH reduction | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0008285 | negative regulation of cell proliferation | biological_proccess | IEA |
GO:0007409 | axonogenesis | biological_proccess | IEA |
GO:0008283 | cell proliferation | biological_proccess | IEA |
GO:0030183 | B cell differentiation | biological_proccess | IEA |
GO:0051384 | response to glucocorticoid stimulus | biological_proccess | IEA |
GO:0048066 | pigmentation during development | biological_proccess | IEA |
GO:0006874 | cellular calcium ion homeostasis | biological_proccess | IEA |
GO:0001822 | kidney development | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0016049 | cell growth | biological_proccess | IEA |
GO:0001503 | ossification | biological_proccess | IEA |
GO:0030318 | melanocyte differentiation | biological_proccess | IEA |
GO:0051881 | regulation of mitochondrial membrane potential | biological_proccess | IEA |
GO:0051402 | neuron apoptosis | biological_proccess | IEA |
GO:0050790 | regulation of catalytic activity | biological_proccess | IEA |
GO:0042221 | response to chemical stimulus | biological_proccess | IEA |
GO:0048545 | response to steroid hormone stimulus | biological_proccess | IEA |
GO:0001101 | response to acid | biological_proccess | IEA |
GO:0018105 | peptidyl-serine phosphorylation | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0048070 | regulation of pigmentation during development | biological_proccess | IEA |
GO:0001656 | metanephros development | biological_proccess | IEA |
GO:0030217 | T cell differentiation | biological_proccess | IEA |
GO:0040007 | growth | biological_proccess | IEA |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IEA |
GO:0001776 | leukocyte homeostasis | biological_proccess | IEA |
GO:0043067 | regulation of programmed cell death | biological_proccess | IEA |
GO:0002260 | lymphocyte homeostasis | biological_proccess | IEA |
GO:0008134 | transcription factor binding | mollecular_function | IEA |
GO:0016563 | transcription activator activity | mollecular_function | IEA |
GO:0046982 | protein heterodimerization activity | mollecular_function | IEA |
GO:0042803 | protein homodimerization activity | mollecular_function | IEA |
GO:0002020 | protease binding | mollecular_function | IEA |
GO:0051434 | BH3 domain binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0000159 | protein phosphatase type 2A complex | cell_component | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005624 | membrane fraction | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005741 | mitochondrial outer membrane | cell_component | IEA |
GO:0005783 | endoplasmic reticulum | cell_component | IEA |
GO:0005789 | endoplasmic reticulum membrane | cell_component | IEA |
GO:0005792 | microsome | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005955 | calcineurin complex | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0031965 | nuclear membrane | cell_component | IEA |
GO:0043209 | myelin sheath | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000002791
- Expression info from Arrayexpress [?] : ENSRNOG00000002791
- Protein expression from Protein Atlas: [?] ENSRNOG00000002791
Click on [?] for more information.