CD36_RAT (Rattus norvegicus)
Description [+]
- Synonyms: CD36_RAT
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Platelet glycoprotein 4 (Platelet glycoprotein IV)(GPIV)(GPIIIB)(PAS IV)(PAS-4)(Fatty acid transport protein)(Fatty acid translocase)(Adipocyte membrane protein)(CD36 antigen) [Source:UniProtKB/Swiss-Prot;Acc:Q07969]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CD36_RAT-R_norvegicus
Structure & Sequence [+]
Protein sequence [+]
CD36_RAT | Rattus norvegicus | 10116 | length:472
MGCDRNCGLITGAVIGAVLAVFGGILMPVGDLLIEKTIKREVVLEEGTIAFKNWVKTGTT
VYRQFWIFDVQNPEEVAKNSSKIKVKQRGPYTYRVRYLAKENITQDPKDSTVSFVQPNGA
IFEPSLSVGTENDNFTVLNLAVAAAPHIYTNSFVQGVLNSLIKKSKSSMFQTRSLKELLW
GYKDPFLSLVPYPISTTVGVFYPYNNTVDGVYKVFNGKDNISKVAIIDTYKGKRNLSYWE
SYCDMINGTDAASFPPFVEKSRTLRFFSSDICRSIYAVFGSEVNLKGIPVYRFVLPANAF
ASPLQNPDNHCFCTEKVISNNCTSYGVLDIGKCKEGKPVYISLPHFLHASPDVSEPIEGL
NPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPARKIEALKNLKRPYIVPILWLNETG
TIGDEKAEMFRNQVTGKIKLLGLVEMVLLGVGVVMFVAFMISYCACRSKNGK
VYRQFWIFDVQNPEEVAKNSSKIKVKQRGPYTYRVRYLAKENITQDPKDSTVSFVQPNGA
IFEPSLSVGTENDNFTVLNLAVAAAPHIYTNSFVQGVLNSLIKKSKSSMFQTRSLKELLW
GYKDPFLSLVPYPISTTVGVFYPYNNTVDGVYKVFNGKDNISKVAIIDTYKGKRNLSYWE
SYCDMINGTDAASFPPFVEKSRTLRFFSSDICRSIYAVFGSEVNLKGIPVYRFVLPANAF
ASPLQNPDNHCFCTEKVISNNCTSYGVLDIGKCKEGKPVYISLPHFLHASPDVSEPIEGL
NPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPARKIEALKNLKRPYIVPILWLNETG
TIGDEKAEMFRNQVTGKIKLLGLVEMVLLGVGVVMFVAFMISYCACRSKNGK
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001676 | long-chain fatty acid metabolic process | biological_proccess | IMP |
GO:0006641 | triglyceride metabolic process | biological_proccess | IMP |
GO:0007155 | cell adhesion | biological_proccess | IEA |
GO:0007584 | response to nutrient | biological_proccess | IEP |
GO:0009612 | response to mechanical stimulus | biological_proccess | IMP |
GO:0014823 | response to activity | biological_proccess | IEP |
GO:0015909 | long-chain fatty acid transport | biological_proccess | IMP |
GO:0016525 | negative regulation of angiogenesis | biological_proccess | IMP |
GO:0019395 | fatty acid oxidation | biological_proccess | IMP |
GO:0032355 | response to estradiol stimulus | biological_proccess | IEP |
GO:0032869 | cellular response to insulin stimulus | biological_proccess | IEP |
GO:0042493 | response to drug | biological_proccess | IEP |
GO:0060416 | response to growth hormone stimulus | biological_proccess | IEP |
GO:0006810 | transport | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IGI |
GO:0005504 | fatty acid binding | mollecular_function | TAS |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0050431 | transforming growth factor beta binding | mollecular_function | IDA |
GO:0070053 | thrombospondin receptor activity | mollecular_function | IDA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005622 | intracellular | cell_component | IDA |
GO:0005739 | mitochondrion | cell_component | IDA |
GO:0005792 | microsome | cell_component | IDA |
GO:0005901 | caveola | cell_component | IDA |
GO:0016021 | integral to membrane | cell_component | TAS |
GO:0042383 | sarcolemma | cell_component | IDA |
GO:0045177 | apical part of cell | cell_component | IDA |
GO:0009986 | cell surface | cell_component | IDA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005764 | lysosome | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000005906
- Expression info from Arrayexpress [?] : ENSRNOG00000005906
- Protein expression from Protein Atlas: [?] ENSRNOG00000005906
Click on [?] for more information.