LYN (Rattus norvegicus)
Description [+]
- Synonyms: LYN
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Tyrosine-protein kinase Lyn (EC 2.7.10.2). [Source:UniProtKB/Swiss-Prot;Acc:Q07014]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: LYN-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | SH3_1 | 66 | 121 |
PFAM A | SH3_2 | 67 | 121 |
PFAM A | SH2 | 129 | 211 |
PFAM A | Pkinase | 247 | 500 |
PFAM A | Pkinase_Tyr | 247 | 497 |
Protein sequence [+]
Lyn | Rattus norvegicus | 10116 | length:512
MGCIKSKRKDNLNDDGVDMKTQPVRNTDRTIYVRDPTSNKQQRPVPESQLLPGQRFQAKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSSKREGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGDFSLSVRDYDPMHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKKLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSAQAFLEEANLMKTLQHD
KLVRLYAVVTKEEPIYIITEFMAKGDLLDFLKSDEGSKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRMENCPDELYDIMKMCW
KESAEERPTFDYLQSVLDDFYTATEGQYQQQP
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSSKREGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGDFSLSVRDYDPMHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKKLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSAQAFLEEANLMKTLQHD
KLVRLYAVVTKEEPIYIITEFMAKGDLLDFLKSDEGSKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRMENCPDELYDIMKMCW
KESAEERPTFDYLQSVLDDFYTATEGQYQQQP
Structure links:
- Smartdomain prediction information: SM00326
- Smartdomain prediction information: SM00252
- Smartdomain prediction information: SM00220
- Smartdomain prediction information: SM00219
- Prosite motif and domain information: PS00107
- Prosite motif and domain information: PS00109
- Interpro domain information: Q07014
- PFAM domain and domain family information: Q07014
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0002553 | histamine secretion by mast cell | biological_proccess | IMP |
GO:0006991 | response to sterol depletion | biological_proccess | IEP |
GO:0007242 | intracellular signaling cascade | biological_proccess | IEA |
GO:0009636 | response to toxin | biological_proccess | IEP |
GO:0009743 | response to carbohydrate stimulus | biological_proccess | IEP |
GO:0014003 | oligodendrocyte development | biological_proccess | IEP |
GO:0014070 | response to organic cyclic substance | biological_proccess | IEP |
GO:0018108 | peptidyl-tyrosine phosphorylation | biological_proccess | IEA |
GO:0030218 | erythrocyte differentiation | biological_proccess | ISS |
GO:0031668 | cellular response to extracellular stimulus | biological_proccess | IEP |
GO:0032868 | response to insulin stimulus | biological_proccess | IEP |
GO:0034605 | cellular response to heat | biological_proccess | IEP |
GO:0042327 | positive regulation of phosphorylation | biological_proccess | IMP |
GO:0042493 | response to drug | biological_proccess | IEP |
GO:0042531 | positive regulation of tyrosine phosphorylation of STAT protein | biological_proccess | ISS |
GO:0043200 | response to amino acid stimulus | biological_proccess | IEP |
GO:0048678 | response to axon injury | biological_proccess | IEP |
GO:0050663 | cytokine secretion | biological_proccess | IMP |
GO:0050853 | B cell receptor signaling pathway | biological_proccess | IEA |
GO:0051279 | regulation of release of sequestered calcium ion into cytosol | biological_proccess | IMP |
GO:0051789 | response to protein stimulus | biological_proccess | IEP |
GO:0060252 | positive regulation of glial cell proliferation | biological_proccess | IDA |
GO:0060369 | positive regulation of Fc receptor mediated stimulatory signaling pathway | biological_proccess | IMP |
GO:0070447 | positive regulation of oligodendrocyte progenitor proliferation | biological_proccess | IMP |
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IEA |
GO:0030218 | erythrocyte differentiation | biological_proccess | IEA |
GO:0009725 | response to hormone stimulus | biological_proccess | IEA |
GO:0042531 | positive regulation of tyrosine phosphorylation of STAT protein | biological_proccess | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0004715 | non-membrane spanning protein tyrosine kinase activity | mollecular_function | IEA |
GO:0005161 | platelet-derived growth factor receptor binding | mollecular_function | IPI |
GO:0005178 | integrin binding | mollecular_function | IDA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0031625 | ubiquitin protein ligase binding | mollecular_function | IPI |
GO:0043208 | glycosphingolipid binding | mollecular_function | IPI |
GO:0051219 | phosphoprotein binding | mollecular_function | IPI |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0005624 | membrane fraction | cell_component | IDA |
GO:0005634 | nucleus | cell_component | ISS |
GO:0005737 | cytoplasm | cell_component | ISS |
GO:0005758 | mitochondrial intermembrane space | cell_component | IDA |
GO:0005886 | plasma membrane | cell_component | IDA |
GO:0014069 | postsynaptic density | cell_component | IDA |
GO:0030061 | mitochondrial crista | cell_component | IDA |
GO:0031966 | mitochondrial membrane | cell_component | IDA |
GO:0034666 | alpha2-beta1 integrin complex | cell_component | IDA |
GO:0045121 | membrane raft | cell_component | IDA |
GO:0045121 | membrane raft | cell_component | IEA |
GO:0005794 | Golgi apparatus | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000008180
- Expression info from Arrayexpress [?] : ENSRNOG00000008180
- Protein expression from Protein Atlas: [?] ENSRNOG00000008180
- entrezgene: 81515
- refseq_dna: NM_001111098
- refseq_dna: NM_030857
- refseq_peptide: NP_110484
- refseq_peptide: NP_001104568
Click on [?] for more information.