TNFSF11 (Rattus norvegicus)
Description [+]
- Synonyms: TNFSF11
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Tumor necrosis factor ligand superfamily member 11 (Receptor activator of nuclear factor kappa B ligand) (RANKL) (TNF-related activation- induced cytokine) (TRANCE) (Osteoprotegerin ligand) (OPGL) (Osteoclast differentiation factor) (ODF) (CD254 antigen) [Source:UniProtKB/Swiss-Prot;Acc:Q9ESE2]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFSF11-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | TNF | 186 | 314 |
Protein sequence [+]
Tnfsf11 | Rattus norvegicus | 10116 | length:318
MRRASRDYGKYLRGSEEMGSCPGVPHEGPLHPAPSAPAPAPPPAASRFMFLALLGLGLGQ
VVCSIALFLYFRAQMDPNRISEDSTRCFYRILRLRENTGLQDSTLESEDTEALPDSCRRM
KQAFQGAVQRELQHIVGPQRFSGVPAMMEGSWLDVARRGKPEAQPFAHLTINAANIPSGS
HKVSLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPADYLQLM
VYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISVQVSNPSLL
DPDQDATYFGAFKVQDID
VVCSIALFLYFRAQMDPNRISEDSTRCFYRILRLRENTGLQDSTLESEDTEALPDSCRRM
KQAFQGAVQRELQHIVGPQRFSGVPAMMEGSWLDVARRGKPEAQPFAHLTINAANIPSGS
HKVSLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPADYLQLM
VYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISVQVSNPSLL
DPDQDATYFGAFKVQDID
Structure links:
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006950 | response to stress | biological_proccess | IEP |
| GO:0006955 | immune response | biological_proccess | IEA |
| GO:0007275 | multicellular organismal development | biological_proccess | IEA |
| GO:0009314 | response to radiation | biological_proccess | IEP |
| GO:0030154 | cell differentiation | biological_proccess | IEA |
| GO:0045672 | positive regulation of osteoclast differentiation | biological_proccess | IMP |
| GO:0045780 | positive regulation of bone resorption | biological_proccess | IMP |
| GO:0009887 | organ morphogenesis | biological_proccess | IEA |
| GO:0001503 | ossification | biological_proccess | IEA |
| GO:0051260 | protein homooligomerization | biological_proccess | IEA |
| GO:0045453 | bone resorption | biological_proccess | IEA |
| GO:0045672 | positive regulation of osteoclast differentiation | biological_proccess | IEA |
| GO:0045670 | regulation of osteoclast differentiation | biological_proccess | IEA |
| GO:0030316 | osteoclast differentiation | biological_proccess | IEA |
| GO:0045780 | positive regulation of bone resorption | biological_proccess | IEA |
| GO:0004872 | receptor activity | mollecular_function | IEA |
| GO:0005125 | cytokine activity | mollecular_function | IEA |
| GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0005576 | extracellular region | cell_component | IEA |
| GO:0005615 | extracellular space | cell_component | IEA |
| GO:0005886 | plasma membrane | cell_component | IEA |
| GO:0016021 | integral to membrane | cell_component | IEA |
| GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000009559
- Expression info from Arrayexpress [?] : ENSRNOG00000009559
- Protein expression from Protein Atlas: [?] ENSRNOG00000009559
Click on [?] for more information.
