NP_001102065.1 (Rattus norvegicus)
Description [+]
- Synonyms: NP_001102065.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae) [Source:RefSeq_peptide;Acc:NP_001102065]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001102065.1-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Acetyltransf_1 | 48 | 139 |
Protein sequence [+]
NP_001102065.1 | Rattus norvegicus | 10116 | length:188
MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYSKYS
TTSTFLVMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDL
FVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPH
PVRPEDIE
TTSTFLVMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDL
FVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPH
PVRPEDIE
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0008152 | metabolic process | biological_proccess | IEA |
GO:0008080 | N-acetyltransferase activity | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0005622 | intracellular | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000010523
- Expression info from Arrayexpress [?] : ENSRNOG00000010523
- Protein expression from Protein Atlas: [?] ENSRNOG00000010523
- entrezgene: 362228
- refseq_dna: NM_001108595
- refseq_peptide: NP_001102065
Click on [?] for more information.