BID (Rattus norvegicus)
Description [+]
- Synonyms: BID
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: BH3-interacting domain death agonist (BID) (p22 BID) [Contains: BH3- interacting domain death agonist p15 (p15 BID); BH3-interacting domain death agonist p13 (p13 BID); BH3-interacting domain death agonist p11 (p11 BID)]. [Source:UniProtKB/Swiss-Prot;Acc:Q9JLT6]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BID-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BID | 1 | 196 |
Protein sequence [+]
Bid | Rattus norvegicus | 10116 | length:196
MDSEVSNGSGLGAEHITNLLVFGFLRNNDRDFHQELEVLGQELPVQVYLEGDREDELQTD
GSRASRSFYHGRIEPDSESQDEVIHNIARHLAQAGDELDHSIQPTLVRQLAAQFMNGSLS
EEDKRNCLAKALDEVKTSFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFRTTVNFIN
QNLFSYVRDLVRNEMD
GSRASRSFYHGRIEPDSESQDEVIHNIARHLAQAGDELDHSIQPTLVRQLAAQFMNGSLS
EEDKRNCLAKALDEVKTSFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFRTTVNFIN
QNLFSYVRDLVRNEMD
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006626 | protein targeting to mitochondrion | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000012439
- Expression info from Arrayexpress [?] : ENSRNOG00000012439
- Protein expression from Protein Atlas: [?] ENSRNOG00000012439
Click on [?] for more information.