TNFSF10 (Rattus norvegicus)
Description [+]
- Synonyms: TNFSF10
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: tumor necrosis factor (ligand) superfamily, member 10 [Source:RefSeq_peptide;Acc:NP_663714]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFSF10-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 156 | 290 |
Protein sequence [+]
Tnfsf10 | Rattus norvegicus | 10116 | length:291
MPSTGNLKGPSFSQHFTMTVICIVLLQVLLQALTVAVTYMYFNNEVKQLQDNYSKIGLAC
FSKEDGDFWDSTDEGILNRPCLQVKRQLYQLIEEVTLRTFEKTISTVPEKQLSTPPLPRG
RRPQRVAAHITGITRRSNLALIPISKDGKTLGQKIETWESSRRGHSFLNHVHLRNGELVI
QEEGLYYIYSQTYYRFKEAKEASKTVSKDGGRIKQMVQYIYKYTSYPDPILLMKSARNSC
WSREAEYGLYSIYQGGLFELKENDRIFVSVTNEHLMDLDQEASFFGAFLIN
FSKEDGDFWDSTDEGILNRPCLQVKRQLYQLIEEVTLRTFEKTISTVPEKQLSTPPLPRG
RRPQRVAAHITGITRRSNLALIPISKDGKTLGQKIETWESSRRGHSFLNHVHLRNGELVI
QEEGLYYIYSQTYYRFKEAKEASKTVSKDGGRIKQMVQYIYKYTSYPDPILLMKSARNSC
WSREAEYGLYSIYQGGLFELKENDRIFVSVTNEHLMDLDQEASFFGAFLIN
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006917 | induction of apoptosis | biological_proccess | NAS |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000013269
- Expression info from Arrayexpress [?] : ENSRNOG00000013269
- Protein expression from Protein Atlas: [?] ENSRNOG00000013269
Click on [?] for more information.