MYD88 (Rattus norvegicus)
Description [+]
- Synonyms: MYD88
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: myeloid differentiation primary response gene 88 [Source:RefSeq_peptide;Acc:NP_937763]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: MYD88-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Death | 31 | 109 |
PFAM A | TIR | 163 | 292 |
Protein sequence [+]
Myd88 | Rattus norvegicus | 10116 | length:296
MSAGGPRVGSVSVDSYLFSLPLVALNVGVRRRLSLFLNPRTTAAADWTSLAEEMGFEYLE
IREFETRPDPTRSLLDAWQGRSGSSVGRLLELLALLDREDILYELKDRIEEDCQKYIRNQ
QKQESEKPLQVARVESSVPQTKELGGITTLDDPLGQTPELFDAFICYCPSDIEFVQEMIR
QLEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGVQQKRLIPIKYKAMKKDFPSILRFITICDYTNPCTKSWFWTRLAKALSLP
IREFETRPDPTRSLLDAWQGRSGSSVGRLLELLALLDREDILYELKDRIEEDCQKYIRNQ
QKQESEKPLQVARVESSVPQTKELGGITTLDDPLGQTPELFDAFICYCPSDIEFVQEMIR
QLEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGVQQKRLIPIKYKAMKKDFPSILRFITICDYTNPCTKSWFWTRLAKALSLP
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0002238 | response to molecule of fungal origin | biological_proccess | IEA |
GO:0002755 | MyD88-dependent toll-like receptor signaling pathway | biological_proccess | IEA |
GO:0008063 | Toll signaling pathway | biological_proccess | IDA |
GO:0009615 | response to virus | biological_proccess | IEA |
GO:0016064 | immunoglobulin mediated immune response | biological_proccess | IEA |
GO:0019221 | cytokine-mediated signaling pathway | biological_proccess | IMP |
GO:0031663 | lipopolysaccharide-mediated signaling pathway | biological_proccess | IEA |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
GO:0032760 | positive regulation of tumor necrosis factor production | biological_proccess | IEA |
GO:0042127 | regulation of cell proliferation | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0045080 | positive regulation of chemokine biosynthetic process | biological_proccess | IEA |
GO:0045087 | innate immune response | biological_proccess | IEA |
GO:0045351 | type I interferon biosynthetic process | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IMP |
GO:0046330 | positive regulation of JNK cascade | biological_proccess | IEA |
GO:0048661 | positive regulation of smooth muscle cell proliferation | biological_proccess | IMP |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0007166 | cell surface receptor linked signal transduction | biological_proccess | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0005121 | Toll binding | mollecular_function | IDA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0031224 | intrinsic to membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000013634
- Expression info from Arrayexpress [?] : ENSRNOG00000013634
- Protein expression from Protein Atlas: [?] ENSRNOG00000013634
Click on [?] for more information.