TNFRSF14 (Rattus norvegicus)
Description [+]
- Synonyms: TNFRSF14
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator) [Source:RefSeq_peptide;Acc:NP_001015034]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFRSF14-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 76 | 117 |
Protein sequence [+]
Tnfrsf14 | Rattus norvegicus | 10116 | length:278
MEPLPGWESSPWSRADNTFRLVPCVFLLNLLQCISAQPLCRQEEFSVGDECCPMCNPGYH
VKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCI
SGYFCENQDGGACSTCLPHAACPPGQRVQKRGTYSHDTVCADCLTGTFSLGGTQEECLPW
TKCSTFQREVKHGTSSTDTTCSFQTFYIVVVIVGVAIVGAGVVVFLLRKQRQRHTSIVAS
ELEAFQQEQQEDAIRFPVIEVGPSVTEEEAAFNCMNSG
VKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCI
SGYFCENQDGGACSTCLPHAACPPGQRVQKRGTYSHDTVCADCLTGTFSLGGTQEECLPW
TKCSTFQREVKHGTSSTDTTCSFQTFYIVVVIVGVAIVGAGVVVFLLRKQRQRHTSIVAS
ELEAFQQEQQEDAIRFPVIEVGPSVTEEEAAFNCMNSG
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0046642 | negative regulation of alpha-beta T cell proliferation | biological_proccess | IEA |
GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000013820
- Expression info from Arrayexpress [?] : ENSRNOG00000013820
- Protein expression from Protein Atlas: [?] ENSRNOG00000013820
- entrezgene: 366518
- refseq_dna: NM_001015034
- refseq_peptide: NP_001015034
Click on [?] for more information.