TRADD (Rattus norvegicus)
Description [+]
- Synonyms: TRADD
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Tumor necrosis factor receptor type 1 associated death domain-like protein (Fragment). [Source:UniProtKB/TrEMBL;Acc:Q8K3Z8]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TRADD-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TRADD_N | 51 | 161 |
Protein sequence [+]
Tradd | Rattus norvegicus | 10116 | length:310
MAADQNGHEEWVGSAYLFLESSMDKVVLSEAYTDPKKKVAIYKALQAALSESGDSPDVLQ
ILKIHCSDPQLIVQLRFCGRLLCGRFLQAYREGALRTALQRCMAAALAQEAVRLQLELRA
GAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDEFCKLTCDSTGQGGATQVAPAGS
KSLVSSPAEEKPLPAAGQTFLFHGQLIVNRPLNLQDQQTFARSVGLKWRRVGRSLQRSCR
ALRDPALDSLAYEYERDGLYEQAFQLLRRFIQAEGRRATLQRLVEALEENELTSLAEDLL
GQAEPEGGQA
ILKIHCSDPQLIVQLRFCGRLLCGRFLQAYREGALRTALQRCMAAALAQEAVRLQLELRA
GAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDEFCKLTCDSTGQGGATQVAPAGS
KSLVSSPAEEKPLPAAGQTFLFHGQLIVNRPLNLQDQQTFARSVGLKWRRVGRSLQRSCR
ALRDPALDSLAYEYERDGLYEQAFQLLRRFIQAEGRRATLQRLVEALEENELTSLAEDLL
GQAEPEGGQA
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0051798 | positive regulation of hair follicle development | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | TAS |
GO:0051291 | protein heterooligomerization | biological_proccess | IPI |
GO:0015986 | ATP synthesis coupled proton transport | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004871 | signal transducer activity | mollecular_function | IEA |
GO:0070513 | death domain binding | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0019900 | kinase binding | mollecular_function | IEA |
GO:0060090 | molecular adaptor activity | mollecular_function | IEA |
GO:0019215 | intermediate filament binding | mollecular_function | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0032403 | protein complex binding | mollecular_function | IPI |
GO:0016820 | hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0043235 | receptor complex | cell_component | IEA |
GO:0043234 | protein complex | cell_component | IDA |
GO:0045121 | membrane raft | cell_component | IDA |
GO:0033178 | proton-transporting two-sector ATPase complex, catalytic domain | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000015179
- Expression info from Arrayexpress [?] : ENSRNOG00000015179
- Protein expression from Protein Atlas: [?] ENSRNOG00000015179
- entrezgene: 246756
Click on [?] for more information.