FADD (Rattus norvegicus)
Description [+]
- Synonyms: FADD
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Fas (TNFRSF6)-associated via death domain [Source:RefSeq_peptide;Acc:NP_690920]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: FADD-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | DED | 4 | 87 |
PFAM A | Death | 98 | 181 |
Protein sequence [+]
Fadd | Rattus norvegicus | 10116 | length:208
MDPFLVLLHSLSSSLSGNDLTDLKFLCRERVSKRKLERVQSGLDLFSVLLEQNDLERGHT
GLLRELLASLGRHDLLQRLDDFEAGATTAATPGEADLRVAFDIVCDNVGRDWKRLARELK
VSEAKIDGIEERYPRSLSDRVRETLRVWKNVEKENASVAGLVKALRACRLNLVADLVEEA
LMAQGSVSKSDDTSSALRDSTVSFSETP
GLLRELLASLGRHDLLQRLDDFEAGATTAATPGEADLRVAFDIVCDNVGRDWKRLARELK
VSEAKIDGIEERYPRSLSDRVRETLRVWKNVEKENASVAGLVKALRACRLNLVADLVEEA
LMAQGSVSKSDDTSSALRDSTVSFSETP
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0051291 | protein heterooligomerization | biological_proccess | IPI |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0070265 | necrotic cell death | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0043234 | protein complex | cell_component | IDA |
GO:0045121 | membrane raft | cell_component | IDA |
GO:0031264 | death-inducing signaling complex | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000020861
- Expression info from Arrayexpress [?] : ENSRNOG00000020861
- Protein expression from Protein Atlas: [?] ENSRNOG00000020861
Click on [?] for more information.