BAX (Rattus norvegicus)
Description [+]
- Synonyms: BAX
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Apoptosis regulator BAX, membrane isoform alpha. [Source:UniProtKB/Swiss-Prot;Acc:Q63690]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BAX-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Bcl-2 | 63 | 158 |
Protein sequence [+]
Bax | Rattus norvegicus | 10116 | length:192
MDGSGDHLGGGGPTSSEQIMKTGAFLLQGFIQDRAERMAGETPELTLEQPPQDASTKKLS
ECLRRIGDELDNNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
ECLRRIGDELDNNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0001541 | ovarian follicle development | biological_proccess | IEP |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IMP |
GO:0006917 | induction of apoptosis | biological_proccess | IMP |
GO:0007007 | inner mitochondrial membrane organization | biological_proccess | IDA |
GO:0007008 | outer mitochondrial membrane organization | biological_proccess | IDA |
GO:0008635 | activation of caspase activity by cytochrome c | biological_proccess | TAS |
GO:0042220 | response to cocaine | biological_proccess | IEP |
GO:0042493 | response to drug | biological_proccess | IEP |
GO:0045333 | cellular respiration | biological_proccess | IDA |
GO:0046688 | response to copper ion | biological_proccess | IEP |
GO:0051412 | response to corticosterone stimulus | biological_proccess | IEP |
GO:0031072 | heat shock protein binding | mollecular_function | IPI |
GO:0046982 | protein heterodimerization activity | mollecular_function | IPI |
GO:0051087 | chaperone binding | mollecular_function | IPI |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005741 | mitochondrial outer membrane | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IDA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000020876
- Expression info from Arrayexpress [?] : ENSRNOG00000020876
- Protein expression from Protein Atlas: [?] ENSRNOG00000020876
Click on [?] for more information.