MGC112688 (Rattus norvegicus)
Description [+]
- Synonyms: MGC112688
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: CD27 antigen [Source:RefSeq_peptide;Acc:NP_001019506]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: MGC112688-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 27 | 62 |
PFAM A | TNFR_c6 | 65 | 104 |
Protein sequence [+]
MGC112688 | Rattus norvegicus | 10116 | length:251
MAWPPLYWLCMLGTLVGLLATPAPNNCPDRHYWIGAGLCCQMCGPGTFLVKHCDQDRAAA
QCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECTCSKGWQCRDQECTEC
DPPLNPALTSQPSEAPSPQLPPPTHLPYATEKPSWPPQRQLPDSTVYSRLPSQRPLCSSD
CIRIFVTFSSMLLVFVLGGILFFHQRRNHGPNEDSQAVPEELCPYSCPREEEGSVIPIQE
DYRKPEPASYP
QCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECTCSKGWQCRDQECTEC
DPPLNPALTSQPSEAPSPQLPPPTHLPYATEKPSWPPQRQLPDSTVYSRLPSQRPLCSSD
CIRIFVTFSSMLLVFVLGGILFFHQRRNHGPNEDSQAVPEELCPYSCPREEEGSVIPIQE
DYRKPEPASYP
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0045471 | response to ethanol | biological_proccess | IDA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0046330 | positive regulation of JNK cascade | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0043027 | caspase inhibitor activity | mollecular_function | IEA |
GO:0005624 | membrane fraction | cell_component | IDA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000027466
- Expression info from Arrayexpress [?] : ENSRNOG00000027466
- Protein expression from Protein Atlas: [?] ENSRNOG00000027466
- entrezgene: 500318
- refseq_dna: NM_001024335
- refseq_peptide: NP_001019506
Click on [?] for more information.