LOC681662 (Rattus norvegicus)
Description [+]
- Synonyms: LOC681662
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description:
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: LOC681662-R_norvegicus
Structure & Sequence [+]
Protein sequence [+]
LOC681662 | Rattus norvegicus | 10116 | length:242
MASSSSVPASSTQSKKPRDKIADWFRQALLKKPKKMPISQESHLSDGSQTATQDGLSPSS
GSSPRSHSSSQSQSSTPSCSSGMSPTSPPTHVDSSSSSSSGRWSKDYDVCVCHSEEDLEV
AQELVSYLEGSKASLRCFLQFRDAAPGGAIVSELCQALSGSHCRVLLITPGFLRDPWCKY
QMLQALTEAPGSEGCTIPLLSGLTRAAYPPELRFMYYVDGRGQDGGFYQVKEAVIHLLDS
MT
GSSPRSHSSSQSQSSTPSCSSGMSPTSPPTHVDSSSSSSSGRWSKDYDVCVCHSEEDLEV
AQELVSYLEGSKASLRCFLQFRDAAPGGAIVSELCQALSGSHCRVLLITPGFLRDPWCKY
QMLQALTEAPGSEGCTIPLLSGLTRAAYPPELRFMYYVDGRGQDGGFYQVKEAVIHLLDS
MT
Structure links:
- Smartdomain prediction information: SM00255
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0045087 | innate immune response | biological_proccess | IEA |
GO:0007249 | I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0007166 | cell surface receptor linked signal transduction | biological_proccess | IEA |
GO:0030099 | myeloid cell differentiation | biological_proccess | IEA |
GO:0004888 | transmembrane receptor activity | mollecular_function | IEA |
GO:0031224 | intrinsic to membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000021420
- Expression info from Arrayexpress [?] : ENSRNOG00000021420
- Protein expression from Protein Atlas: [?] ENSRNOG00000021420
Click on [?] for more information.